Detailed information    

insolico Bioinformatically predicted

Overview


Name   ssb   Type   Machinery gene
Locus tag   OLM03_RS04100 Genome accession   NZ_CP110039
Coordinates   827970..828497 (+) Length   175 a.a.
NCBI ID   WP_063855925.1    Uniprot ID   -
Organism   Enterococcus faecalis strain BE47     
Function   ssDNA binding (predicted from homology)   
DNA processing

Related MGE


Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.

Gene-MGE association summary

MGE type MGE coordinates Gene coordinates Relative position Distance (bp)
Prophage 815889..854062 827970..828497 within 0


Gene organization within MGE regions


Location: 815889..854062
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  OLM03_RS03995 (OLM03_03995) eis 815889..817082 (+) 1194 WP_264547525.1 enhanced intracellular survival protein Eis -
  OLM03_RS04005 (OLM03_04005) - 817547..818683 (-) 1137 WP_264547526.1 site-specific integrase -
  OLM03_RS04010 (OLM03_04010) - 818809..819393 (-) 585 WP_002401949.1 DUF4352 domain-containing protein -
  OLM03_RS04015 (OLM03_04015) - 819475..819897 (-) 423 WP_010729101.1 ImmA/IrrE family metallo-endopeptidase -
  OLM03_RS04020 (OLM03_04020) - 819915..820235 (-) 321 WP_128437535.1 helix-turn-helix domain-containing protein -
  OLM03_RS04025 (OLM03_04025) - 820535..821302 (+) 768 WP_141426545.1 phage antirepressor KilAC domain-containing protein -
  OLM03_RS04030 (OLM03_04030) - 821326..821529 (+) 204 WP_002296611.1 helix-turn-helix domain-containing protein -
  OLM03_RS04035 (OLM03_04035) - 821545..821874 (+) 330 WP_141442174.1 DUF771 domain-containing protein -
  OLM03_RS04040 (OLM03_04040) - 821932..822102 (+) 171 WP_010784067.1 hypothetical protein -
  OLM03_RS04045 (OLM03_04045) - 822266..822679 (-) 414 WP_010784066.1 hypothetical protein -
  OLM03_RS04050 (OLM03_04050) - 822757..823470 (+) 714 WP_264547527.1 Rha family transcriptional regulator -
  OLM03_RS04055 (OLM03_04055) - 823481..823666 (+) 186 WP_002411350.1 hypothetical protein -
  OLM03_RS04060 (OLM03_04060) - 823678..823851 (+) 174 WP_002364664.1 hypothetical protein -
  OLM03_RS04065 (OLM03_04065) - 824051..824173 (+) 123 WP_002399179.1 hypothetical protein -
  OLM03_RS04070 (OLM03_04070) - 824157..824636 (+) 480 WP_002381628.1 siphovirus Gp157 family protein -
  OLM03_RS04075 (OLM03_04075) - 824648..825664 (+) 1017 WP_002381629.1 AAA family ATPase -
  OLM03_RS04080 (OLM03_04080) - 825669..826310 (+) 642 WP_002401957.1 putative HNHc nuclease -
  OLM03_RS04085 (OLM03_04085) - 826316..826801 (+) 486 WP_033598031.1 hypothetical protein -
  OLM03_RS04090 (OLM03_04090) - 826821..827672 (+) 852 WP_141417322.1 DNA replication protein -
  OLM03_RS04095 (OLM03_04095) - 827672..827980 (+) 309 WP_002381633.1 MazG-like family protein -
  OLM03_RS04100 (OLM03_04100) ssb 827970..828497 (+) 528 WP_063855925.1 single-stranded DNA-binding protein Machinery gene
  OLM03_RS04105 (OLM03_04105) - 828510..828839 (+) 330 WP_063855926.1 hypothetical protein -
  OLM03_RS04110 (OLM03_04110) - 828859..829065 (+) 207 WP_002395813.1 hypothetical protein -
  OLM03_RS04115 (OLM03_04115) - 829083..829331 (+) 249 WP_264547528.1 hypothetical protein -
  OLM03_RS04120 (OLM03_04120) - 829542..830024 (+) 483 WP_104888323.1 hypothetical protein -
  OLM03_RS04125 (OLM03_04125) - 830021..830281 (+) 261 WP_002399914.1 hypothetical protein -
  OLM03_RS04130 (OLM03_04130) - 830274..830681 (+) 408 WP_264547529.1 DUF1642 domain-containing protein -
  OLM03_RS04135 (OLM03_04135) - 830864..831073 (+) 210 WP_113848049.1 hypothetical protein -
  OLM03_RS04140 (OLM03_04140) - 831074..831493 (+) 420 WP_002404562.1 transcriptional regulator -
  OLM03_RS04145 (OLM03_04145) - 833207..833560 (+) 354 WP_064687107.1 phBC6A51 family helix-turn-helix protein -
  OLM03_RS04150 (OLM03_04150) - 833550..834824 (+) 1275 WP_224798902.1 PBSX family phage terminase large subunit -
  OLM03_RS04155 (OLM03_04155) - 834837..836312 (+) 1476 WP_141417316.1 phage portal protein -
  OLM03_RS04160 (OLM03_04160) - 836287..837333 (+) 1047 WP_141417315.1 phage head morphogenesis protein -
  OLM03_RS04165 (OLM03_04165) - 837336..837656 (+) 321 WP_104884664.1 hypothetical protein -
  OLM03_RS04170 (OLM03_04170) - 837661..837957 (+) 297 WP_156189951.1 hypothetical protein -
  OLM03_RS04175 (OLM03_04175) - 837962..838204 (+) 243 WP_141417314.1 glutaredoxin domain-containing protein -
  OLM03_RS04180 (OLM03_04180) - 838208..838471 (+) 264 WP_077932911.1 DUF6275 family protein -
  OLM03_RS04185 (OLM03_04185) - 838611..839237 (+) 627 WP_141417313.1 DUF4355 domain-containing protein -
  OLM03_RS04190 (OLM03_04190) - 839251..840153 (+) 903 WP_104858705.1 DUF5309 family protein -
  OLM03_RS04195 (OLM03_04195) - 840177..840413 (+) 237 WP_002372022.1 hypothetical protein -
  OLM03_RS04200 (OLM03_04200) - 840422..840766 (+) 345 WP_224798886.1 hypothetical protein -
  OLM03_RS04205 (OLM03_04205) - 840763..841140 (+) 378 WP_002404932.1 hypothetical protein -
  OLM03_RS04210 (OLM03_04210) - 841133..841531 (+) 399 WP_002395884.1 HK97 gp10 family phage protein -
  OLM03_RS04215 (OLM03_04215) - 841535..841909 (+) 375 WP_016634615.1 DUF6838 family protein -
  OLM03_RS04220 (OLM03_04220) - 841910..842752 (+) 843 WP_264547530.1 major tail protein -
  OLM03_RS04225 (OLM03_04225) gpG 842805..843158 (+) 354 WP_002364485.1 phage tail assembly chaperone G -
  OLM03_RS04230 (OLM03_04230) - 843407..846301 (+) 2895 WP_264547588.1 tape measure protein -
  OLM03_RS04235 (OLM03_04235) - 846291..847025 (+) 735 WP_264547531.1 phage tail protein -
  OLM03_RS04240 (OLM03_04240) - 847007..849814 (+) 2808 WP_264547532.1 phage tail spike protein -
  OLM03_RS04245 (OLM03_04245) - 849833..850738 (+) 906 WP_264547533.1 phage baseplate upper protein -
  OLM03_RS04250 (OLM03_04250) - 850735..851052 (+) 318 WP_264547534.1 hypothetical protein -
  OLM03_RS04255 (OLM03_04255) - 851045..851362 (+) 318 WP_010823170.1 hypothetical protein -
  OLM03_RS04260 (OLM03_04260) - 851362..851850 (+) 489 WP_264547535.1 hypothetical protein -
  OLM03_RS04265 (OLM03_04265) - 851861..852181 (+) 321 WP_104874258.1 hypothetical protein -
  OLM03_RS04270 (OLM03_04270) - 852183..852338 (+) 156 WP_002364192.1 XkdX family protein -
  OLM03_RS04275 (OLM03_04275) - 852373..852594 (+) 222 WP_002406118.1 hypothetical protein -
  OLM03_RS04280 (OLM03_04280) - 852587..852820 (+) 234 WP_264547536.1 phage holin -
  OLM03_RS04285 (OLM03_04285) - 852821..854062 (+) 1242 WP_264547537.1 LysM peptidoglycan-binding domain-containing protein -

Sequence


Protein


Download         Length: 175 a.a.        Molecular weight: 19325.21 Da        Isoelectric Point: 4.6968

>NTDB_id=751629 OLM03_RS04100 WP_063855925.1 827970..828497(+) (ssb) [Enterococcus faecalis strain BE47]
MINNVVLIGRLTKDIDLRYTASGSAVGSFTLAVNRNFTNQNGDREADFINCVIWRKPAETMANYARKGTLLGVVGRIQTR
NYDNQQGQRVYVTEVVCESFQLLEPKSANENRNSIQSSQNSVTGVQNNFESNYATNQNKGLNQQNNSQQMSFGGDVDPFA
GAGNSIDISDDDLPF

Nucleotide


Download         Length: 528 bp        

>NTDB_id=751629 OLM03_RS04100 WP_063855925.1 827970..828497(+) (ssb) [Enterococcus faecalis strain BE47]
ATGATAAATAATGTGGTATTAATCGGAAGGCTGACGAAAGATATAGATTTACGCTACACCGCAAGTGGTTCTGCAGTTGG
AAGCTTTACTCTTGCTGTGAACCGTAACTTTACGAATCAAAATGGTGACCGTGAAGCAGACTTTATCAACTGTGTGATTT
GGCGTAAGCCTGCTGAAACAATGGCTAATTATGCTCGCAAAGGAACATTATTAGGAGTTGTTGGAAGAATTCAAACTCGT
AATTATGACAACCAACAAGGCCAACGTGTCTATGTGACTGAAGTTGTTTGCGAGAGTTTCCAATTATTAGAGCCAAAAAG
CGCCAATGAGAATAGAAATAGCATTCAGAGTTCACAGAATAGCGTTACAGGCGTTCAAAATAATTTCGAGAGTAATTATG
CCACGAATCAAAACAAAGGCTTAAATCAGCAAAATAACAGCCAACAAATGTCGTTTGGTGGAGATGTAGATCCGTTCGCA
GGCGCAGGTAATTCAATCGACATTAGCGATGATGATCTGCCGTTCTAG


Secondary structure


Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure


Source ID Structure

Transmembrane helices


Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.



Visualization of predicted probability:


Similar proteins


Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  ssb Latilactobacillus sakei subsp. sakei 23K

58.989

100

0.6

  ssbA Bacillus subtilis subsp. subtilis str. 168

57.865

100

0.589