Detailed information    

insolico Bioinformatically predicted

Overview


Name   comGD   Type   Machinery gene
Locus tag   L0P93_RS13920 Genome accession   NZ_CP109795
Coordinates   2746231..2746668 (-) Length   145 a.a.
NCBI ID   WP_007612572.1    Uniprot ID   -
Organism   Bacillus velezensis strain B19     
Function   dsDNA binding to the cell surface; assembly of the pseudopilus (predicted from homology)   
DNA binding and uptake

Genomic Context


Location: 2741231..2751668
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  L0P93_RS13870 (L0P93_13870) sinI 2741614..2741787 (+) 174 WP_014418369.1 anti-repressor SinI family protein Regulator
  L0P93_RS13875 (L0P93_13875) sinR 2741821..2742156 (+) 336 WP_003153104.1 transcriptional regulator SinR Regulator
  L0P93_RS13880 (L0P93_13880) - 2742204..2742989 (-) 786 WP_007408329.1 TasA family protein -
  L0P93_RS13885 (L0P93_13885) - 2743054..2743638 (-) 585 WP_012117977.1 signal peptidase I -
  L0P93_RS13890 (L0P93_13890) tapA 2743610..2744281 (-) 672 WP_277160785.1 amyloid fiber anchoring/assembly protein TapA -
  L0P93_RS13895 (L0P93_13895) - 2744540..2744869 (+) 330 WP_012117979.1 DUF3889 domain-containing protein -
  L0P93_RS13900 (L0P93_13900) - 2744910..2745089 (-) 180 WP_003153093.1 YqzE family protein -
  L0P93_RS13905 (L0P93_13905) comGG 2745146..2745523 (-) 378 WP_017418138.1 competence type IV pilus minor pilin ComGG Machinery gene
  L0P93_RS13910 (L0P93_13910) comGF 2745524..2745988 (-) 465 WP_233717055.1 competence type IV pilus minor pilin ComGF -
  L0P93_RS13915 (L0P93_13915) comGE 2745933..2746247 (-) 315 WP_029973875.1 competence type IV pilus minor pilin ComGE Machinery gene
  L0P93_RS13920 (L0P93_13920) comGD 2746231..2746668 (-) 438 WP_007612572.1 competence type IV pilus minor pilin ComGD Machinery gene
  L0P93_RS13925 (L0P93_13925) comGC 2746658..2746966 (-) 309 WP_014418376.1 competence type IV pilus major pilin ComGC Machinery gene
  L0P93_RS13930 (L0P93_13930) comGB 2746971..2748008 (-) 1038 WP_014418377.1 competence type IV pilus assembly protein ComGB Machinery gene
  L0P93_RS13935 (L0P93_13935) comGA 2747995..2749065 (-) 1071 WP_014418378.1 competence type IV pilus ATPase ComGA Machinery gene
  L0P93_RS13940 (L0P93_13940) - 2749258..2750208 (-) 951 WP_014418379.1 magnesium transporter CorA family protein -
  L0P93_RS13945 (L0P93_13945) - 2750354..2751655 (+) 1302 WP_029973873.1 hemolysin family protein -

Sequence


Protein


Download         Length: 145 a.a.        Molecular weight: 16254.76 Da        Isoelectric Point: 10.1850

>NTDB_id=749249 L0P93_RS13920 WP_007612572.1 2746231..2746668(-) (comGD) [Bacillus velezensis strain B19]
MNNNRRTENGFTLLESLIVLSLASVLLTVLFTTVPPVCTHLAVRQKTEQLQKDIQLAQETAIAEHKRTKITFLPKEHKYK
LQSGGRIVERSFDSLHITLVTLPESLEFNEKGHPNSGGKIQLKSAGFTYEITVYLGSGNVHAKRK

Nucleotide


Download         Length: 438 bp        

>NTDB_id=749249 L0P93_RS13920 WP_007612572.1 2746231..2746668(-) (comGD) [Bacillus velezensis strain B19]
TTGAACAATAACAGGCGGACAGAAAATGGGTTTACCCTTCTTGAAAGCCTGATTGTGTTAAGCCTGGCGTCCGTCCTGCT
GACGGTTTTGTTCACGACGGTTCCGCCGGTCTGCACCCACCTTGCCGTGCGGCAAAAAACAGAACAGCTCCAAAAAGATA
TTCAGCTTGCTCAGGAAACGGCTATCGCAGAACATAAAAGAACAAAAATCACTTTTCTTCCAAAAGAGCATAAATACAAA
CTGCAGTCAGGCGGAAGGATTGTCGAGCGTTCTTTTGATTCGCTTCACATTACGCTTGTGACTTTACCGGAGAGCCTTGA
ATTTAACGAAAAAGGCCATCCGAATTCGGGAGGAAAGATACAATTGAAGAGCGCCGGGTTCACCTATGAGATCACAGTTT
ACTTAGGGAGCGGAAATGTCCATGCTAAACGGAAATAA


Secondary structure


Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure


Source ID Structure

Transmembrane helices


Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.



Visualization of predicted probability:


Similar proteins


Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  comGD Bacillus subtilis subsp. subtilis str. 168

55.479

100

0.559