Detailed information    

insolico Bioinformatically predicted

Overview

Name   sinI   Type   Regulator
Locus tag   L0P93_RS13870 Genome accession   NZ_CP109795
Coordinates   2741614..2741787 (+) Length   57 a.a.
NCBI ID   WP_014418369.1    Uniprot ID   I2C7P2
Organism   Bacillus velezensis strain B19     
Function   inhibit the expression of sinR (predicted from homology)   
Competence regulation

Genomic Context

Location: 2736614..2746787
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  L0P93_RS13855 (L0P93_13855) gcvT 2737427..2738527 (-) 1101 WP_029973877.1 glycine cleavage system aminomethyltransferase GcvT -
  L0P93_RS13860 (L0P93_13860) - 2738951..2740621 (+) 1671 WP_021494309.1 SNF2-related protein -
  L0P93_RS13865 (L0P93_13865) - 2740643..2741437 (+) 795 WP_014418368.1 YqhG family protein -
  L0P93_RS13870 (L0P93_13870) sinI 2741614..2741787 (+) 174 WP_014418369.1 anti-repressor SinI family protein Regulator
  L0P93_RS13875 (L0P93_13875) sinR 2741821..2742156 (+) 336 WP_003153104.1 transcriptional regulator SinR Regulator
  L0P93_RS13880 (L0P93_13880) - 2742204..2742989 (-) 786 WP_007408329.1 TasA family protein -
  L0P93_RS13885 (L0P93_13885) - 2743054..2743638 (-) 585 WP_012117977.1 signal peptidase I -
  L0P93_RS13890 (L0P93_13890) tapA 2743610..2744281 (-) 672 WP_277160785.1 amyloid fiber anchoring/assembly protein TapA -
  L0P93_RS13895 (L0P93_13895) - 2744540..2744869 (+) 330 WP_012117979.1 DUF3889 domain-containing protein -
  L0P93_RS13900 (L0P93_13900) - 2744910..2745089 (-) 180 WP_003153093.1 YqzE family protein -
  L0P93_RS13905 (L0P93_13905) comGG 2745146..2745523 (-) 378 WP_017418138.1 competence type IV pilus minor pilin ComGG Machinery gene
  L0P93_RS13910 (L0P93_13910) comGF 2745524..2745988 (-) 465 WP_233717055.1 competence type IV pilus minor pilin ComGF -
  L0P93_RS13915 (L0P93_13915) comGE 2745933..2746247 (-) 315 WP_029973875.1 competence type IV pilus minor pilin ComGE Machinery gene
  L0P93_RS13920 (L0P93_13920) comGD 2746231..2746668 (-) 438 WP_007612572.1 competence type IV pilus minor pilin ComGD Machinery gene

Sequence

Protein


Download         Length: 57 a.a.        Molecular weight: 6642.60 Da        Isoelectric Point: 9.8168

>NTDB_id=749245 L0P93_RS13870 WP_014418369.1 2741614..2741787(+) (sinI) [Bacillus velezensis strain B19]
MKNAKTEFSQLDKEWVELILEAQKANISLEEIRKYLLSNKKSSQHIQAARSHTVNPF

Nucleotide


Download         Length: 174 bp        

>NTDB_id=749245 L0P93_RS13870 WP_014418369.1 2741614..2741787(+) (sinI) [Bacillus velezensis strain B19]
ATGAAAAATGCAAAAACAGAATTTTCGCAATTAGATAAGGAATGGGTTGAGCTGATATTAGAAGCCCAAAAAGCAAATAT
CAGCCTAGAAGAAATACGCAAATACCTGCTTTCGAATAAAAAGTCTTCTCAACATATCCAGGCAGCCAGAAGTCATACCG
TAAATCCTTTCTGA

Domains

Predicted by InterproScan.

Anti-repressor SinI (SinI)

(11-37)


Secondary structure

Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure

Source ID Structure
  AlphaFold DB I2C7P2

Transmembrane helices

Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.


Visualization of predicted probability:


Similar proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  sinI Bacillus subtilis subsp. subtilis str. 168

71.93

100

0.719