Detailed information    

insolico Bioinformatically predicted

Overview

Name   degQ   Type   Regulator
Locus tag   N8A73_RS14600 Genome accession   NZ_CP109651
Coordinates   2819474..2819614 (-) Length   46 a.a.
NCBI ID   WP_003213123.1    Uniprot ID   A0A5K1N966
Organism   Bacillus safensis strain LG01     
Function   modification of regulators (predicted from homology)   
Competence regulation

Genomic Context

Location: 2814474..2824614
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  N8A73_RS14575 - 2814740..2815129 (-) 390 WP_024423321.1 hotdog fold thioesterase -
  N8A73_RS14580 comA 2815153..2815794 (-) 642 WP_034282566.1 response regulator transcription factor Regulator
  N8A73_RS14585 comP 2815875..2818187 (-) 2313 WP_034282568.1 ATP-binding protein Regulator
  N8A73_RS14590 comX 2818241..2818411 (-) 171 WP_073207246.1 competence pheromone ComX -
  N8A73_RS14595 - 2818408..2819322 (-) 915 WP_176967247.1 polyprenyl synthetase family protein -
  N8A73_RS14600 degQ 2819474..2819614 (-) 141 WP_003213123.1 degradation enzyme regulation protein DegQ Regulator
  N8A73_RS14605 - 2820120..2820476 (+) 357 WP_041115816.1 hypothetical protein -
  N8A73_RS14610 - 2820512..2821738 (-) 1227 WP_176967282.1 EAL and HDOD domain-containing protein -
  N8A73_RS14615 - 2821876..2823348 (-) 1473 WP_041115814.1 nicotinate phosphoribosyltransferase -
  N8A73_RS14620 - 2823366..2823917 (-) 552 WP_024425949.1 cysteine hydrolase family protein -
  N8A73_RS14625 - 2823978..2824385 (-) 408 WP_034282575.1 YueI family protein -

Sequence

Protein


Download         Length: 46 a.a.        Molecular weight: 5677.42 Da        Isoelectric Point: 4.6828

>NTDB_id=748760 N8A73_RS14600 WP_003213123.1 2819474..2819614(-) (degQ) [Bacillus safensis strain LG01]
MEKYEIEELKQLLWKLENEIRETTASLHNINKSIDQYDKYEYVKIS

Nucleotide


Download         Length: 141 bp        

>NTDB_id=748760 N8A73_RS14600 WP_003213123.1 2819474..2819614(-) (degQ) [Bacillus safensis strain LG01]
ATGGAAAAGTATGAAATCGAAGAACTTAAACAATTATTATGGAAACTTGAAAACGAAATCAGAGAAACAACGGCTTCTCT
TCATAACATTAACAAAAGCATTGATCAATACGACAAATATGAATATGTGAAAATTTCTTAA

Domains

Predicted by InterproScan.

DegQ (SacQ) family (DegQ)

(1-46)


Secondary structure

Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure

Source ID Structure
  AlphaFold DB A0A5K1N966

Transmembrane helices

Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.


Visualization of predicted probability:


Similar proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  degQ Bacillus subtilis subsp. subtilis str. 168

68.085

100

0.696