Detailed information
Overview
| Name | degQ | Type | Regulator |
| Locus tag | N8A73_RS14600 | Genome accession | NZ_CP109651 |
| Coordinates | 2819474..2819614 (-) | Length | 46 a.a. |
| NCBI ID | WP_003213123.1 | Uniprot ID | A0A5K1N966 |
| Organism | Bacillus safensis strain LG01 | ||
| Function | modification of regulators (predicted from homology) Competence regulation |
||
Genomic Context
Location: 2814474..2824614
| Locus tag | Gene name | Coordinates (strand) | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| N8A73_RS14575 | - | 2814740..2815129 (-) | 390 | WP_024423321.1 | hotdog fold thioesterase | - |
| N8A73_RS14580 | comA | 2815153..2815794 (-) | 642 | WP_034282566.1 | response regulator transcription factor | Regulator |
| N8A73_RS14585 | comP | 2815875..2818187 (-) | 2313 | WP_034282568.1 | ATP-binding protein | Regulator |
| N8A73_RS14590 | comX | 2818241..2818411 (-) | 171 | WP_073207246.1 | competence pheromone ComX | - |
| N8A73_RS14595 | - | 2818408..2819322 (-) | 915 | WP_176967247.1 | polyprenyl synthetase family protein | - |
| N8A73_RS14600 | degQ | 2819474..2819614 (-) | 141 | WP_003213123.1 | degradation enzyme regulation protein DegQ | Regulator |
| N8A73_RS14605 | - | 2820120..2820476 (+) | 357 | WP_041115816.1 | hypothetical protein | - |
| N8A73_RS14610 | - | 2820512..2821738 (-) | 1227 | WP_176967282.1 | EAL and HDOD domain-containing protein | - |
| N8A73_RS14615 | - | 2821876..2823348 (-) | 1473 | WP_041115814.1 | nicotinate phosphoribosyltransferase | - |
| N8A73_RS14620 | - | 2823366..2823917 (-) | 552 | WP_024425949.1 | cysteine hydrolase family protein | - |
| N8A73_RS14625 | - | 2823978..2824385 (-) | 408 | WP_034282575.1 | YueI family protein | - |
Sequence
Protein
Download Length: 46 a.a. Molecular weight: 5677.42 Da Isoelectric Point: 4.6828
>NTDB_id=748760 N8A73_RS14600 WP_003213123.1 2819474..2819614(-) (degQ) [Bacillus safensis strain LG01]
MEKYEIEELKQLLWKLENEIRETTASLHNINKSIDQYDKYEYVKIS
MEKYEIEELKQLLWKLENEIRETTASLHNINKSIDQYDKYEYVKIS
Nucleotide
Download Length: 141 bp
>NTDB_id=748760 N8A73_RS14600 WP_003213123.1 2819474..2819614(-) (degQ) [Bacillus safensis strain LG01]
ATGGAAAAGTATGAAATCGAAGAACTTAAACAATTATTATGGAAACTTGAAAACGAAATCAGAGAAACAACGGCTTCTCT
TCATAACATTAACAAAAGCATTGATCAATACGACAAATATGAATATGTGAAAATTTCTTAA
ATGGAAAAGTATGAAATCGAAGAACTTAAACAATTATTATGGAAACTTGAAAACGAAATCAGAGAAACAACGGCTTCTCT
TCATAACATTAACAAAAGCATTGATCAATACGACAAATATGAATATGTGAAAATTTCTTAA
3D structure
| Source | ID | Structure |
|---|
Similar proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|---|---|---|---|
| degQ | Bacillus subtilis subsp. subtilis str. 168 |
68.085 |
100 |
0.696 |