Detailed information    

insolico Bioinformatically predicted

Overview


Name   ssbA   Type   Machinery gene
Locus tag   F6Y18_RS13780 Genome accession   NZ_AP020316
Coordinates   2741564..2742007 (+) Length   147 a.a.
NCBI ID   WP_001099009.1    Uniprot ID   A0A0C6EXF8
Organism   Staphylococcus aureus strain KUH140331     
Function   ssDNA binding (predicted from homology)   
DNA processing

Related MGE


Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.

Gene-MGE association summary

MGE type MGE coordinates Gene coordinates Relative position Distance (bp)
Prophage 2726092..2750930 2741564..2742007 within 0


Gene organization within MGE regions


Location: 2726092..2750930
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  F6Y18_RS13665 (KUH140331_2546) - 2726092..2726535 (+) 444 WP_000361985.1 hypothetical protein -
  F6Y18_RS13670 (KUH140331_2547) - 2727258..2728481 (-) 1224 WP_000206642.1 ArgE/DapE family deacylase -
  F6Y18_RS13675 (KUH140331_2548) lukH 2728917..2729972 (+) 1056 WP_000791418.1 bi-component leukocidin LukGH subunit H -
  F6Y18_RS13680 (KUH140331_2549) lukG 2729994..2731010 (+) 1017 WP_000595393.1 bi-component leukocidin LukGH subunit G -
  F6Y18_RS13685 (KUH140331_2550) sph 2731248..2732072 (-) 825 Protein_2604 sphingomyelin phosphodiesterase -
  F6Y18_RS13690 (KUH140331_2551) - 2732129..2733166 (-) 1038 WP_150030519.1 tyrosine-type recombinase/integrase -
  F6Y18_RS13695 (KUH140331_2552) - 2733359..2734063 (-) 705 WP_017804779.1 type II toxin-antitoxin system PemK/MazF family toxin -
  F6Y18_RS13700 (KUH140331_2553) - 2734203..2734370 (-) 168 WP_031808066.1 hypothetical protein -
  F6Y18_RS13705 (KUH140331_2554) - 2734570..2735286 (-) 717 WP_001083969.1 LexA family transcriptional regulator -
  F6Y18_RS13710 (KUH140331_2555) - 2735450..2735692 (+) 243 WP_000639925.1 DUF739 family protein -
  F6Y18_RS13715 (KUH140331_2556) - 2735708..2736496 (+) 789 WP_070046044.1 phage antirepressor -
  F6Y18_RS13720 (KUH140331_2557) - 2736510..2736770 (+) 261 WP_000435341.1 transcriptional regulator -
  F6Y18_RS13725 (KUH140331_2558) - 2736794..2737333 (-) 540 WP_000351243.1 hypothetical protein -
  F6Y18_RS13730 (KUH140331_2559) - 2737390..2738139 (+) 750 WP_117207726.1 phage antirepressor KilAC domain-containing protein -
  F6Y18_RS13735 (KUH140331_2560) - 2738155..2738352 (+) 198 WP_001148861.1 hypothetical protein -
  F6Y18_RS13740 (KUH140331_2561) - 2738383..2738523 (+) 141 WP_000939496.1 hypothetical protein -
  F6Y18_RS13745 (KUH140331_2562) - 2738538..2739170 (-) 633 WP_000275058.1 hypothetical protein -
  F6Y18_RS13750 (KUH140331_2563) - 2739229..2739549 (+) 321 WP_001120197.1 DUF771 domain-containing protein -
  F6Y18_RS13755 (KUH140331_2564) - 2739546..2739707 (+) 162 WP_000066020.1 DUF1270 domain-containing protein -
  F6Y18_RS13760 (KUH140331_2565) - 2739797..2740126 (+) 330 WP_000138304.1 hypothetical protein -
  F6Y18_RS13765 (KUH140331_2566) - 2740107..2740367 (+) 261 WP_031880059.1 DUF1108 family protein -
  F6Y18_RS13770 (KUH140331_2567) - 2740380..2740916 (+) 537 WP_001004336.1 host-nuclease inhibitor Gam family protein -
  F6Y18_RS13775 (KUH140331_2568) - 2740917..2741567 (+) 651 WP_000840496.1 ERF family protein -
  F6Y18_RS13780 (KUH140331_2569) ssbA 2741564..2742007 (+) 444 WP_001099009.1 single-stranded DNA-binding protein Machinery gene
  F6Y18_RS13785 (KUH140331_2570) - 2742019..2742693 (+) 675 WP_063456299.1 putative HNHc nuclease -
  F6Y18_RS13790 (KUH140331_2572) - 2742803..2743462 (-) 660 WP_016028252.1 hypothetical protein -
  F6Y18_RS13795 (KUH140331_2573) - 2743508..2744278 (+) 771 WP_000190226.1 conserved phage C-terminal domain-containing protein -
  F6Y18_RS13800 (KUH140331_2574) - 2744288..2745061 (+) 774 WP_117216985.1 ATP-binding protein -
  F6Y18_RS13805 (KUH140331_2575) - 2745055..2745213 (+) 159 WP_015997089.1 hypothetical protein -
  F6Y18_RS13810 (KUH140331_2576) - 2745226..2745449 (+) 224 Protein_2629 DUF3269 family protein -
  F6Y18_RS13820 (KUH140331_2577) - 2745460..2745864 (+) 405 WP_000049784.1 DUF1064 domain-containing protein -
  F6Y18_RS13825 (KUH140331_2578) - 2745869..2746054 (+) 186 WP_001187242.1 DUF3113 family protein -
  F6Y18_RS13830 (KUH140331_2579) - 2746055..2746426 (+) 372 WP_115282698.1 SA1788 family PVL leukocidin-associated protein -
  F6Y18_RS13835 (KUH140331_2580) - 2746426..2746683 (+) 258 WP_000022720.1 DUF3310 domain-containing protein -
  F6Y18_RS13840 (KUH140331_2581) - 2746686..2746886 (+) 201 WP_000235326.1 hypothetical protein -
  F6Y18_RS13845 (KUH140331_2582) - 2746895..2747143 (+) 249 WP_117216382.1 SAV1978 family virulence-associated passenger protein -
  F6Y18_RS13850 (KUH140331_2583) - 2747157..2747408 (+) 252 WP_001065074.1 DUF1024 family protein -
  F6Y18_RS13955 (KUH140331_2584) - 2747398..2747571 (+) 174 WP_000028424.1 hypothetical protein -
  F6Y18_RS13855 (KUH140331_2585) - 2747572..2747853 (+) 282 WP_000454994.1 hypothetical protein -
  F6Y18_RS13960 (KUH140331_2586) - 2747854..2748015 (+) 162 WP_172571785.1 hypothetical protein -
  F6Y18_RS13860 (KUH140331_2587) - 2748030..2748557 (+) 528 WP_117216380.1 dUTPase -
  F6Y18_RS13865 (KUH140331_2588) - 2748594..2748800 (+) 207 WP_000195810.1 DUF1381 domain-containing protein -
  F6Y18_RS13870 (KUH140331_2589) rinB 2748797..2748946 (+) 150 WP_000595265.1 transcriptional activator RinB -
  F6Y18_RS13875 (KUH140331_2591) - 2749105..2749755 (+) 651 WP_001005262.1 hypothetical protein -
  F6Y18_RS13880 (KUH140331_2592) - 2749755..2749955 (+) 201 WP_001794311.1 DUF1514 family protein -
  F6Y18_RS13885 (KUH140331_2593) - 2749983..2750399 (+) 417 WP_000590122.1 hypothetical protein -
  F6Y18_RS13890 (KUH140331_2594) - 2750631..2750930 (+) 300 WP_000988336.1 HNH endonuclease -

Sequence


Protein


Download         Length: 147 a.a.        Molecular weight: 16321.89 Da        Isoelectric Point: 5.8347

>NTDB_id=74697 F6Y18_RS13780 WP_001099009.1 2741564..2742007(+) (ssbA) [Staphylococcus aureus strain KUH140331]
MNTVNLIGNLVADPELKGQNNNVVNFVIAVQRPFKNKQTNEYETDFIRCVAFGKTAEIIANNFNKGNKIGVTGSIQTGSY
ENNQGQKVFTTDIAVNNITFVERKNNGQSNNQQQHNSYNAPQNRQQSNNPFANANGPIEISDDDLPF

Nucleotide


Download         Length: 444 bp        

>NTDB_id=74697 F6Y18_RS13780 WP_001099009.1 2741564..2742007(+) (ssbA) [Staphylococcus aureus strain KUH140331]
ATGAATACAGTAAATTTAATTGGGAACCTAGTGGCAGATCCAGAGTTAAAAGGTCAAAACAACAACGTAGTTAACTTTGT
AATCGCAGTACAGAGACCATTCAAAAACAAACAAACTAACGAATATGAAACAGACTTCATTCGTTGTGTTGCATTTGGTA
AGACTGCTGAAATCATCGCTAATAACTTTAATAAAGGTAATAAAATTGGCGTTACTGGTTCAATACAAACCGGTAGTTAT
GAAAATAATCAAGGACAGAAAGTGTTTACTACAGACATCGCAGTCAACAATATAACTTTCGTTGAACGTAAAAACAACGG
TCAATCTAACAACCAACAACAGCATAATTCATATAACGCACCACAGAATAGACAGCAATCAAATAATCCATTTGCTAATG
CTAATGGTCCTATAGAAATCTCTGACGATGATTTACCTTTCTAG


Secondary structure


Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure


Source ID Structure
  AlphaFold DB A0A0C6EXF8

Transmembrane helices


Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.



Visualization of predicted probability:


Similar proteins


Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  ssbA Bacillus subtilis subsp. subtilis str. 168

41.279

100

0.483

  ssb Latilactobacillus sakei subsp. sakei 23K

38.235

100

0.442


Multiple sequence alignment