Detailed information    

insolico Bioinformatically predicted

Overview

Name   sinI   Type   Regulator
Locus tag   OGL87_RS12210 Genome accession   NZ_CP107557
Coordinates   2350883..2351056 (-) Length   57 a.a.
NCBI ID   WP_032874029.1    Uniprot ID   -
Organism   Bacillus velezensis strain CPA1-1     
Function   inhibit the expression of sinR (predicted from homology)   
Competence regulation

Genomic Context

Location: 2345883..2356056
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  OGL87_RS12160 (OGL87_12160) comGD 2346002..2346439 (+) 438 WP_007612572.1 competence type IV pilus minor pilin ComGD Machinery gene
  OGL87_RS12165 (OGL87_12165) comGE 2346423..2346737 (+) 315 WP_032874016.1 competence type IV pilus minor pilin ComGE Machinery gene
  OGL87_RS12170 (OGL87_12170) comGF 2346646..2347146 (+) 501 WP_223204419.1 competence type IV pilus minor pilin ComGF -
  OGL87_RS12175 (OGL87_12175) comGG 2347147..2347524 (+) 378 WP_032874019.1 competence type IV pilus minor pilin ComGG Machinery gene
  OGL87_RS12180 (OGL87_12180) - 2347581..2347760 (+) 180 WP_022552966.1 YqzE family protein -
  OGL87_RS12185 (OGL87_12185) - 2347801..2348130 (-) 330 WP_032874021.1 DUF3889 domain-containing protein -
  OGL87_RS12190 (OGL87_12190) tapA 2348389..2349060 (+) 672 WP_032874023.1 amyloid fiber anchoring/assembly protein TapA -
  OGL87_RS12195 (OGL87_12195) sipW 2349032..2349616 (+) 585 WP_032874025.1 signal peptidase I SipW -
  OGL87_RS12200 (OGL87_12200) tasA 2349681..2350466 (+) 786 WP_032874027.1 biofilm matrix protein TasA -
  OGL87_RS12205 (OGL87_12205) sinR 2350514..2350849 (-) 336 WP_003153104.1 transcriptional regulator SinR Regulator
  OGL87_RS12210 (OGL87_12210) sinI 2350883..2351056 (-) 174 WP_032874029.1 anti-repressor SinI Regulator
  OGL87_RS12215 (OGL87_12215) - 2351233..2352027 (-) 795 WP_007612541.1 YqhG family protein -
  OGL87_RS12220 (OGL87_12220) - 2352049..2353719 (-) 1671 WP_032874031.1 DEAD/DEAH box helicase -
  OGL87_RS12225 (OGL87_12225) gcvT 2354142..2355242 (+) 1101 WP_032874033.1 glycine cleavage system aminomethyltransferase GcvT -

Sequence

Protein


Download         Length: 57 a.a.        Molecular weight: 6658.66 Da        Isoelectric Point: 9.8168

>NTDB_id=740672 OGL87_RS12210 WP_032874029.1 2350883..2351056(-) (sinI) [Bacillus velezensis strain CPA1-1]
MKNAKMEFSQLDKEWVELILEAQKANISLEEIRKYLLSNKKSSQHVQAARSHTVNPF

Nucleotide


Download         Length: 174 bp        

>NTDB_id=740672 OGL87_RS12210 WP_032874029.1 2350883..2351056(-) (sinI) [Bacillus velezensis strain CPA1-1]
ATGAAAAATGCAAAAATGGAATTTTCGCAATTAGATAAGGAATGGGTTGAGCTGATATTAGAAGCCCAAAAAGCAAATAT
CAGCCTAGAAGAAATACGCAAATACCTGCTTTCGAATAAAAAGTCTTCTCAACATGTCCAGGCAGCCAGAAGTCATACCG
TAAATCCTTTCTGA

Domains

Predicted by InterproScan.

Anti-repressor SinI (SinI)

(11-37)


Secondary structure

Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure

Source ID Structure

Transmembrane helices

Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.


Visualization of predicted probability:


Similar proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  sinI Bacillus subtilis subsp. subtilis str. 168

71.93

100

0.719