Detailed information    

insolico Bioinformatically predicted

Overview

Name   comGG   Type   Machinery gene
Locus tag   OGL87_RS12175 Genome accession   NZ_CP107557
Coordinates   2347147..2347524 (+) Length   125 a.a.
NCBI ID   WP_032874019.1    Uniprot ID   -
Organism   Bacillus velezensis strain CPA1-1     
Function   dsDNA binding to the cell surface; assembly of the pseudopilus (predicted from homology)   
DNA binding and uptake

Genomic Context

Location: 2342147..2352524
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  OGL87_RS12140 (OGL87_12140) - 2342458..2343408 (+) 951 WP_032874012.1 magnesium transporter CorA family protein -
  OGL87_RS12145 (OGL87_12145) comGA 2343605..2344675 (+) 1071 WP_003153083.1 competence type IV pilus ATPase ComGA Machinery gene
  OGL87_RS12150 (OGL87_12150) comGB 2344662..2345699 (+) 1038 WP_032874014.1 competence type IV pilus assembly protein ComGB Machinery gene
  OGL87_RS12155 (OGL87_12155) comGC 2345704..2346012 (+) 309 WP_003153087.1 competence type IV pilus major pilin ComGC Machinery gene
  OGL87_RS12160 (OGL87_12160) comGD 2346002..2346439 (+) 438 WP_007612572.1 competence type IV pilus minor pilin ComGD Machinery gene
  OGL87_RS12165 (OGL87_12165) comGE 2346423..2346737 (+) 315 WP_032874016.1 competence type IV pilus minor pilin ComGE Machinery gene
  OGL87_RS12170 (OGL87_12170) comGF 2346646..2347146 (+) 501 WP_223204419.1 competence type IV pilus minor pilin ComGF -
  OGL87_RS12175 (OGL87_12175) comGG 2347147..2347524 (+) 378 WP_032874019.1 competence type IV pilus minor pilin ComGG Machinery gene
  OGL87_RS12180 (OGL87_12180) - 2347581..2347760 (+) 180 WP_022552966.1 YqzE family protein -
  OGL87_RS12185 (OGL87_12185) - 2347801..2348130 (-) 330 WP_032874021.1 DUF3889 domain-containing protein -
  OGL87_RS12190 (OGL87_12190) tapA 2348389..2349060 (+) 672 WP_032874023.1 amyloid fiber anchoring/assembly protein TapA -
  OGL87_RS12195 (OGL87_12195) sipW 2349032..2349616 (+) 585 WP_032874025.1 signal peptidase I SipW -
  OGL87_RS12200 (OGL87_12200) tasA 2349681..2350466 (+) 786 WP_032874027.1 biofilm matrix protein TasA -
  OGL87_RS12205 (OGL87_12205) sinR 2350514..2350849 (-) 336 WP_003153104.1 transcriptional regulator SinR Regulator
  OGL87_RS12210 (OGL87_12210) sinI 2350883..2351056 (-) 174 WP_032874029.1 anti-repressor SinI Regulator
  OGL87_RS12215 (OGL87_12215) - 2351233..2352027 (-) 795 WP_007612541.1 YqhG family protein -

Sequence

Protein


Download         Length: 125 a.a.        Molecular weight: 14077.01 Da        Isoelectric Point: 10.2236

>NTDB_id=740670 OGL87_RS12175 WP_032874019.1 2347147..2347524(+) (comGG) [Bacillus velezensis strain CPA1-1]
MSKSDGFIYPAVLFVSAAVLLVISYTSSDFITRKTFAKEAGEYWIGENLLQNGALLSSRHMAQGKKARTGTQRFPYGTVS
FHISGSDRRETVQVTIQTETTTGTRREAHLLFDQKKKQLIQWTEV

Nucleotide


Download         Length: 378 bp        

>NTDB_id=740670 OGL87_RS12175 WP_032874019.1 2347147..2347524(+) (comGG) [Bacillus velezensis strain CPA1-1]
ATGTCCAAATCTGACGGTTTTATATATCCCGCGGTTCTGTTTGTTTCTGCCGCAGTTTTACTTGTCATCAGCTATACTTC
ATCTGATTTCATCACCCGAAAAACATTTGCAAAAGAGGCAGGGGAGTACTGGATCGGAGAGAACCTGCTCCAAAACGGCG
CGCTGCTGTCAAGCCGCCATATGGCACAGGGAAAAAAGGCCCGAACTGGTACACAGCGTTTTCCGTATGGCACCGTTTCT
TTTCACATCTCCGGGAGTGATCGCCGGGAAACGGTTCAGGTTACAATTCAGACGGAAACCACGACAGGTACGAGACGGGA
GGCTCACCTTTTGTTCGATCAGAAGAAGAAACAGCTGATTCAATGGACGGAAGTATAA

Domains

Predicted by InterproScan.

ComG operon protein 7 (ComGG)

(30-124)


Secondary structure

Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure

Source ID Structure

Transmembrane helices

Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.


Visualization of predicted probability:


Similar proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  comGG Bacillus subtilis subsp. subtilis str. 168

49.194

99.2

0.488