Detailed information    

insolico Bioinformatically predicted

Overview

Name   pilI   Type   Machinery gene
Locus tag   OHM05_RS06875 Genome accession   NZ_CP107272
Coordinates   1317701..1318315 (-) Length   204 a.a.
NCBI ID   WP_012503479.1    Uniprot ID   -
Organism   Neisseria gonorrhoeae strain 1130991     
Function   type IV pilus (predicted from homology)   
DNA binding and uptake

Related MGE

Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.

Gene-MGE association summary

MGE type MGE coordinates Gene coordinates Relative position Distance (bp)
Prophage 1277343..1326059 1317701..1318315 within 0


Gene organization within MGE regions


Location: 1277343..1326059
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  OHM05_RS06610 (OHM05_06610) - 1277343..1278188 (+) 846 WP_047921371.1 Bro-N domain-containing protein -
  OHM05_RS06615 (OHM05_06615) - 1278225..1278374 (-) 150 WP_003706419.1 hypothetical protein -
  OHM05_RS06620 (OHM05_06620) - 1278377..1279051 (-) 675 WP_003687998.1 hypothetical protein -
  OHM05_RS06625 (OHM05_06625) - 1279048..1279533 (-) 486 WP_003687997.1 hypothetical protein -
  OHM05_RS06630 (OHM05_06630) - 1279539..1280012 (-) 474 WP_003690936.1 hypothetical protein -
  OHM05_RS06635 (OHM05_06635) - 1280067..1281362 (-) 1296 WP_003690933.1 DUF4043 family protein -
  OHM05_RS11870 - 1281988..1287897 (-) 5910 WP_033909227.1 PLxRFG domain-containing protein -
  OHM05_RS06650 (OHM05_06650) - 1288100..1289314 (-) 1215 WP_044270986.1 hypothetical protein -
  OHM05_RS06655 (OHM05_06655) - 1289311..1290507 (-) 1197 WP_003687992.1 hypothetical protein -
  OHM05_RS06660 (OHM05_06660) - 1290744..1293011 (-) 2268 WP_229689248.1 hypothetical protein -
  OHM05_RS06665 (OHM05_06665) - 1292996..1294270 (-) 1275 WP_003701186.1 PBSX family phage terminase large subunit -
  OHM05_RS06670 (OHM05_06670) - 1294251..1294790 (-) 540 WP_003690920.1 hypothetical protein -
  OHM05_RS06675 (OHM05_06675) - 1294790..1295212 (-) 423 WP_003690919.1 hypothetical protein -
  OHM05_RS06680 (OHM05_06680) - 1295277..1295795 (-) 519 WP_003687984.1 HNH endonuclease -
  OHM05_RS06685 (OHM05_06685) - 1295786..1296169 (-) 384 WP_003690918.1 recombination protein NinB -
  OHM05_RS06690 (OHM05_06690) - 1296166..1296471 (-) 306 WP_003687981.1 nuclease domain-containing protein -
  OHM05_RS06695 (OHM05_06695) - 1296464..1296901 (-) 438 WP_017147288.1 RusA family crossover junction endodeoxyribonuclease -
  OHM05_RS06700 (OHM05_06700) - 1296892..1297173 (-) 282 WP_003689109.1 hypothetical protein -
  OHM05_RS06705 (OHM05_06705) - 1297202..1297351 (-) 150 WP_003689110.1 hypothetical protein -
  OHM05_RS06710 (OHM05_06710) - 1297528..1298022 (-) 495 WP_041421248.1 DUF3310 domain-containing protein -
  OHM05_RS06715 (OHM05_06715) - 1298061..1298324 (-) 264 WP_154235845.1 hypothetical protein -
  OHM05_RS06720 (OHM05_06720) - 1298361..1299722 (-) 1362 WP_003689132.1 DnaB-like helicase C-terminal domain-containing protein -
  OHM05_RS06725 (OHM05_06725) - 1299719..1300783 (-) 1065 WP_050154181.1 hypothetical protein -
  OHM05_RS06730 (OHM05_06730) - 1300901..1301128 (-) 228 WP_003698261.1 helix-turn-helix domain-containing protein -
  OHM05_RS06735 (OHM05_06735) - 1301509..1302225 (+) 717 WP_003695999.1 helix-turn-helix transcriptional regulator -
  OHM05_RS06740 (OHM05_06740) - 1302385..1302924 (+) 540 WP_003695998.1 Panacea domain-containing protein -
  OHM05_RS06745 (OHM05_06745) - 1302925..1303284 (+) 360 WP_003691733.1 hypothetical protein -
  OHM05_RS06750 (OHM05_06750) - 1303301..1303519 (-) 219 WP_003691731.1 hypothetical protein -
  OHM05_RS06755 (OHM05_06755) - 1304003..1304203 (+) 201 WP_047917349.1 hypothetical protein -
  OHM05_RS06760 (OHM05_06760) - 1304236..1304712 (+) 477 WP_002255718.1 DUF6948 domain-containing protein -
  OHM05_RS06765 (OHM05_06765) - 1304709..1304996 (+) 288 WP_047926276.1 hypothetical protein -
  OHM05_RS06770 (OHM05_06770) - 1305138..1305470 (+) 333 WP_050155386.1 hypothetical protein -
  OHM05_RS06775 (OHM05_06775) - 1305623..1305898 (+) 276 WP_082295533.1 NGO1622 family putative holin -
  OHM05_RS06780 (OHM05_06780) - 1305895..1306056 (+) 162 WP_003693867.1 hypothetical protein -
  OHM05_RS06785 (OHM05_06785) - 1306125..1306811 (+) 687 WP_033910330.1 phage replication initiation protein, NGO0469 family -
  OHM05_RS06790 (OHM05_06790) - 1306951..1307133 (+) 183 WP_003691535.1 hypothetical protein -
  OHM05_RS06795 (OHM05_06795) - 1307130..1307621 (+) 492 WP_047916888.1 siphovirus Gp157 family protein -
  OHM05_RS06800 (OHM05_06800) - 1307673..1307888 (+) 216 WP_003691538.1 hypothetical protein -
  OHM05_RS11875 - 1307999..1308265 (+) 267 Protein_1310 hypothetical protein -
  OHM05_RS06810 (OHM05_06810) - 1308546..1309229 (+) 684 WP_003687929.1 DUF2786 domain-containing protein -
  OHM05_RS06815 (OHM05_06815) - 1309424..1309693 (+) 270 WP_003687928.1 hypothetical protein -
  OHM05_RS06820 (OHM05_06820) - 1310049..1311249 (-) 1201 Protein_1313 tyrosine-type recombinase/integrase -
  OHM05_RS06835 (OHM05_06835) yaaA 1311779..1312558 (-) 780 WP_003687925.1 peroxide stress protein YaaA -
  OHM05_RS06840 (OHM05_06840) dapC 1312714..1313901 (-) 1188 WP_003701073.1 succinyldiaminopimelate transaminase -
  OHM05_RS06845 (OHM05_06845) dut 1313973..1314425 (-) 453 WP_003701071.1 dUTP diphosphatase -
  OHM05_RS06850 (OHM05_06850) - 1314591..1315302 (+) 712 Protein_1317 AzlC family ABC transporter permease -
  OHM05_RS06855 (OHM05_06855) - 1315299..1315607 (+) 309 WP_003706588.1 AzlD family protein -
  OHM05_RS06860 (OHM05_06860) pilL 1315677..1316153 (-) 477 WP_263946612.1 PilX family type IV pilin Machinery gene
  OHM05_RS06865 (OHM05_06865) pilK 1316155..1316763 (-) 609 WP_047921847.1 PilX N-terminal domain-containing pilus assembly protein Machinery gene
  OHM05_RS06870 (OHM05_06870) pilJ 1316742..1317704 (-) 963 WP_047921846.1 PilW family protein Machinery gene
  OHM05_RS06875 (OHM05_06875) pilI 1317701..1318315 (-) 615 WP_012503479.1 type IV pilus modification protein PilV Machinery gene
  OHM05_RS06880 (OHM05_06880) pilH 1318347..1319009 (-) 663 WP_047916986.1 Tfp pilus assembly protein FimT/FimU Machinery gene
  OHM05_RS11975 - 1319160..1319272 (+) 113 Protein_1324 IS5/IS1182 family transposase -
  OHM05_RS06885 (OHM05_06885) dnaB 1319266..1320669 (-) 1404 WP_012503477.1 replicative DNA helicase -
  OHM05_RS06890 (OHM05_06890) - 1320833..1321414 (+) 582 WP_003690895.1 superoxide dismutase -
  OHM05_RS06895 (OHM05_06895) - 1321646..1322155 (-) 510 WP_003687909.1 isoprenylcysteine carboxyl methyltransferase family protein -
  OHM05_RS06900 (OHM05_06900) - 1322485..1322817 (-) 333 WP_003687908.1 hypothetical protein -
  OHM05_RS06905 (OHM05_06905) cysT 1323003..1323832 (+) 830 Protein_1329 sulfate ABC transporter permease subunit CysT -
  OHM05_RS06910 (OHM05_06910) cysW 1324021..1324842 (+) 822 WP_012503473.1 sulfate ABC transporter permease subunit CysW -
  OHM05_RS06915 (OHM05_06915) - 1324826..1324960 (+) 135 Protein_1331 IS5/IS1182 family transposase -
  OHM05_RS06920 (OHM05_06920) - 1324983..1326059 (+) 1077 WP_003687905.1 sulfate/molybdate ABC transporter ATP-binding protein -

Sequence

Protein


Download         Length: 204 a.a.        Molecular weight: 22099.99 Da        Isoelectric Point: 4.9673

>NTDB_id=739079 OHM05_RS06875 WP_012503479.1 1317701..1318315(-) (pilI) [Neisseria gonorrhoeae strain 1130991]
MKNNDCLRLKNPQSGMALIEVLVAMLVLTIGILALLSVQLRTVASVREAETQTIVSQITQNLMEGMLMNPTIDSDSNKKN
YNLYTGPYTPTPSGGDFKLNNNNLISKKDLAKAQLDRFDYELRNALPDAVAIHYAVCKDSSGGAPTLSGGTFSPNCDNKA
NGDTLIKVLWVNDSAGDSDISRTNLEVSGDNIVYTYQARVGGHE

Nucleotide


Download         Length: 615 bp        

>NTDB_id=739079 OHM05_RS06875 WP_012503479.1 1317701..1318315(-) (pilI) [Neisseria gonorrhoeae strain 1130991]
ATGAAGAATAATGATTGCTTGCGCCTGAAAAATCCCCAGTCCGGTATGGCGTTGATAGAAGTCTTGGTCGCTATGCTCGT
TCTGACCATCGGTATTTTGGCATTGCTGTCCGTACAGTTGCGGACGGTCGCTTCCGTCAGGGAGGCGGAGACACAAACCA
TCGTCAGCCAAATCACGCAAAACCTGATGGAAGGAATGTTGATGAATCCGACCATTGATTCGGACAGCAACAAGAAAAAC
TATAATCTTTACACGGGGCCGTACACCCCCACTCCCTCTGGCGGCGATTTCAAGCTTAATAATAATAATTTGATAAGTAA
GAAGGATTTGGCAAAAGCCCAGTTGGACAGGTTCGATTATGAATTGAGAAACGCCTTGCCGGATGCGGTAGCTATTCATT
ACGCCGTCTGCAAGGATTCGTCGGGTGGCGCGCCGACATTGTCCGGCGGTACTTTTTCTCCAAATTGCGATAATAAGGCA
AACGGGGATACTTTGATTAAAGTATTGTGGGTAAATGATTCGGCAGGGGATTCGGATATTTCCCGTACGAATCTTGAGGT
GAGCGGCGACAATATCGTATATACCTATCAGGCAAGGGTCGGAGGTCATGAATGA

Domains

Predicted by InterproScan.

Prokaryotic N-terminal methylation motif (N_methyl)

(11-36)


Secondary structure

Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure

Source ID Structure

Transmembrane helices

Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.


Visualization of predicted probability:


Similar proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  pilI Neisseria gonorrhoeae MS11

90.686

100

0.907
  pilV Neisseria gonorrhoeae MS11

90.686

100

0.907
  pilV Neisseria meningitidis 8013

84.135

100

0.858