Detailed information    

insolico Bioinformatically predicted

Overview

Name   pilL   Type   Machinery gene
Locus tag   OHL99_RS02920 Genome accession   NZ_CP107270
Coordinates   565655..566128 (+) Length   157 a.a.
NCBI ID   WP_012503482.1    Uniprot ID   -
Organism   Neisseria gonorrhoeae strain 1081168     
Function   type IV pilus (predicted from homology)   
DNA binding and uptake

Related MGE

Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.

Gene-MGE association summary

MGE type MGE coordinates Gene coordinates Relative position Distance (bp)
Prophage 566198..604461 565655..566128 flank 70


Gene organization within MGE regions


Location: 565655..604461
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  OHL99_RS02920 (OHL99_02920) pilL 565655..566128 (+) 474 WP_012503482.1 PilX family type IV pilin Machinery gene
  OHL99_RS02925 (OHL99_02925) - 566198..566506 (-) 309 WP_003706588.1 AzlD family protein -
  OHL99_RS02930 (OHL99_02930) - 566503..567214 (-) 712 Protein_565 AzlC family ABC transporter permease -
  OHL99_RS02935 (OHL99_02935) dut 567380..567832 (+) 453 WP_003701071.1 dUTP diphosphatase -
  OHL99_RS02940 (OHL99_02940) dapC 567904..569091 (+) 1188 WP_003701073.1 succinyldiaminopimelate transaminase -
  OHL99_RS02945 (OHL99_02945) yaaA 569247..570026 (+) 780 WP_003687925.1 peroxide stress protein YaaA -
  OHL99_RS02960 (OHL99_02960) - 570556..571756 (+) 1201 Protein_569 tyrosine-type recombinase/integrase -
  OHL99_RS02965 (OHL99_02965) - 572112..572381 (-) 270 WP_003687928.1 hypothetical protein -
  OHL99_RS02970 (OHL99_02970) - 572576..573259 (-) 684 WP_003687929.1 DUF2786 domain-containing protein -
  OHL99_RS11835 - 573540..573806 (-) 267 Protein_572 hypothetical protein -
  OHL99_RS02980 (OHL99_02980) - 573917..574132 (-) 216 WP_003691538.1 hypothetical protein -
  OHL99_RS02985 (OHL99_02985) - 574184..574675 (-) 492 WP_010359966.1 siphovirus Gp157 family protein -
  OHL99_RS02990 (OHL99_02990) - 574672..574854 (-) 183 WP_003691535.1 hypothetical protein -
  OHL99_RS02995 (OHL99_02995) - 574994..575680 (-) 687 WP_010359969.1 phage replication initiation protein, NGO0469 family -
  OHL99_RS03000 (OHL99_03000) - 575749..575910 (-) 162 WP_003693867.1 hypothetical protein -
  OHL99_RS03005 (OHL99_03005) - 575907..576182 (-) 276 WP_003703838.1 NGO1622 family putative holin -
  OHL99_RS03010 (OHL99_03010) - 576335..576667 (-) 333 WP_003695500.1 hypothetical protein -
  OHL99_RS03015 (OHL99_03015) - 576808..577095 (-) 288 WP_050171272.1 hypothetical protein -
  OHL99_RS03020 (OHL99_03020) - 577092..577568 (-) 477 WP_002255718.1 DUF6948 domain-containing protein -
  OHL99_RS03025 (OHL99_03025) - 577601..577801 (-) 201 WP_003704298.1 hypothetical protein -
  OHL99_RS03030 (OHL99_03030) - 578285..578503 (+) 219 WP_003691731.1 hypothetical protein -
  OHL99_RS03035 (OHL99_03035) - 578520..578879 (-) 360 WP_047918230.1 hypothetical protein -
  OHL99_RS03040 (OHL99_03040) - 578880..579419 (-) 540 WP_003695998.1 Panacea domain-containing protein -
  OHL99_RS03045 (OHL99_03045) - 579579..580295 (-) 717 WP_003695999.1 helix-turn-helix transcriptional regulator -
  OHL99_RS03050 (OHL99_03050) - 580676..580903 (+) 228 WP_003698261.1 helix-turn-helix domain-containing protein -
  OHL99_RS03055 (OHL99_03055) - 581021..582085 (+) 1065 WP_003689134.1 hypothetical protein -
  OHL99_RS03060 (OHL99_03060) - 582082..583443 (+) 1362 WP_003689132.1 DnaB-like helicase C-terminal domain-containing protein -
  OHL99_RS03065 (OHL99_03065) - 583460..583690 (+) 231 WP_050154378.1 hypothetical protein -
  OHL99_RS03070 (OHL99_03070) - 583782..584276 (+) 495 WP_041421248.1 DUF3310 domain-containing protein -
  OHL99_RS03075 (OHL99_03075) - 584453..584602 (+) 150 WP_003689110.1 hypothetical protein -
  OHL99_RS03080 (OHL99_03080) - 584631..584912 (+) 282 WP_003689109.1 hypothetical protein -
  OHL99_RS03085 (OHL99_03085) - 584903..585340 (+) 438 WP_017147288.1 RusA family crossover junction endodeoxyribonuclease -
  OHL99_RS03090 (OHL99_03090) - 585333..585638 (+) 306 WP_003687981.1 nuclease domain-containing protein -
  OHL99_RS03095 (OHL99_03095) - 585635..586018 (+) 384 WP_003690918.1 recombination protein NinB -
  OHL99_RS03100 (OHL99_03100) - 586009..586527 (+) 519 WP_003687984.1 HNH endonuclease -
  OHL99_RS03105 (OHL99_03105) - 586592..587014 (+) 423 WP_003690919.1 hypothetical protein -
  OHL99_RS03110 (OHL99_03110) - 587014..587553 (+) 540 WP_003690920.1 hypothetical protein -
  OHL99_RS03115 (OHL99_03115) - 587534..588808 (+) 1275 WP_003701186.1 PBSX family phage terminase large subunit -
  OHL99_RS03120 (OHL99_03120) - 588793..591060 (+) 2268 WP_229689248.1 hypothetical protein -
  OHL99_RS03125 (OHL99_03125) - 591297..592493 (+) 1197 WP_003687992.1 hypothetical protein -
  OHL99_RS03130 (OHL99_03130) - 592490..593704 (+) 1215 WP_044270986.1 hypothetical protein -
  OHL99_RS11985 - 593907..599816 (+) 5910 WP_033909227.1 PLxRFG domain-containing protein -
  OHL99_RS03145 (OHL99_03145) - 600442..601737 (+) 1296 WP_003690933.1 DUF4043 family protein -
  OHL99_RS03150 (OHL99_03150) - 601792..602265 (+) 474 WP_003690936.1 hypothetical protein -
  OHL99_RS03155 (OHL99_03155) - 602271..602756 (+) 486 WP_003687997.1 hypothetical protein -
  OHL99_RS03160 (OHL99_03160) - 602753..603427 (+) 675 WP_003687998.1 hypothetical protein -
  OHL99_RS03165 (OHL99_03165) - 603430..603579 (+) 150 WP_003706419.1 hypothetical protein -
  OHL99_RS03170 (OHL99_03170) - 603616..604461 (-) 846 WP_047921371.1 Bro-N domain-containing protein -

Sequence

Protein


Download         Length: 157 a.a.        Molecular weight: 17486.30 Da        Isoelectric Point: 9.9561

>NTDB_id=738978 OHL99_RS02920 WP_012503482.1 565655..566128(+) (pilL) [Neisseria gonorrhoeae strain 1081168]
MEQKGFTLIEMMIVVAILGIISVIAIPSYQSYIEKGYQSQLYTEMVGINNVLKQFILKNPQDNNQIIKSKLETFVLGYKM
NPKIAKKYSVSVAFANTEKPRAYRLVGVPKAGTGYTLSVWMNSVGDGYKCRNATSAQTYSETLSANTGCEAFSNRKK

Nucleotide


Download         Length: 474 bp        

>NTDB_id=738978 OHL99_RS02920 WP_012503482.1 565655..566128(+) (pilL) [Neisseria gonorrhoeae strain 1081168]
ATGGAACAAAAAGGGTTTACATTGATTGAGATGATGATAGTTGTCGCGATACTCGGCATTATCAGCGTCATTGCCATACC
TTCTTATCAAAGTTATATTGAAAAAGGCTATCAGTCCCAGCTTTATACGGAGATGGTCGGTATCAACAATGTTCTCAAAC
AGTTTATTTTGAAAAATCCCCAGGACAATAATCAGATCATCAAGAGCAAACTGGAAACATTTGTCTTAGGCTATAAGATG
AATCCGAAAATTGCCAAAAAATATAGTGTTTCGGTGGCATTTGCCAATACGGAAAAACCAAGGGCATACAGGTTGGTCGG
CGTTCCGAAGGCAGGGACGGGTTATACCTTGTCGGTATGGATGAACAGCGTGGGCGACGGATACAAATGCCGTAATGCCA
CTTCTGCCCAGACCTATTCGGAGACCTTGTCCGCAAATACCGGCTGTGAAGCTTTCTCTAATCGTAAAAAATAG

Domains

Predicted by InterproScan.

Prokaryotic N-terminal methylation motif (N_methyl)

(3-25)

Minor type IV pilin, PilX (Pilin_PilX)

(31-157)


Secondary structure

Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure

Source ID Structure

Transmembrane helices

Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.


Visualization of predicted probability:


Similar proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  pilL Neisseria gonorrhoeae MS11

91.72

100

0.917
  pilX Neisseria meningitidis 8013

85.35

100

0.854