Detailed information    

insolico Bioinformatically predicted

Overview


Name   comGD   Type   Machinery gene
Locus tag   OD347_RS12130 Genome accession   NZ_CP107079
Coordinates   2422747..2423184 (-) Length   145 a.a.
NCBI ID   WP_045510590.1    Uniprot ID   -
Organism   Bacillus velezensis strain LT-2     
Function   dsDNA binding to the cell surface; assembly of the pseudopilus (predicted from homology)   
DNA binding and uptake

Genomic Context


Location: 2417747..2428184
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  OD347_RS12080 sinI 2418130..2418303 (+) 174 WP_013352860.1 anti-repressor SinI Regulator
  OD347_RS12085 sinR 2418337..2418672 (+) 336 WP_014470659.1 transcriptional regulator SinR Regulator
  OD347_RS12090 tasA 2418720..2419505 (-) 786 WP_013352862.1 biofilm matrix protein TasA -
  OD347_RS12095 sipW 2419570..2420154 (-) 585 WP_065522773.1 signal peptidase I SipW -
  OD347_RS12100 tapA 2420126..2420797 (-) 672 WP_088613114.1 amyloid fiber anchoring/assembly protein TapA -
  OD347_RS12105 - 2421055..2421384 (+) 330 WP_045510605.1 DUF3889 domain-containing protein -
  OD347_RS12110 - 2421425..2421604 (-) 180 WP_016938971.1 YqzE family protein -
  OD347_RS12115 comGG 2421661..2422038 (-) 378 WP_088613115.1 competence type IV pilus minor pilin ComGG Machinery gene
  OD347_RS12120 comGF 2422040..2422540 (-) 501 WP_235608361.1 competence type IV pilus minor pilin ComGF -
  OD347_RS12125 comGE 2422449..2422763 (-) 315 WP_045510593.1 competence type IV pilus minor pilin ComGE Machinery gene
  OD347_RS12130 comGD 2422747..2423184 (-) 438 WP_045510590.1 competence type IV pilus minor pilin ComGD Machinery gene
  OD347_RS12135 comGC 2423174..2423482 (-) 309 WP_013352870.1 competence type IV pilus major pilin ComGC Machinery gene
  OD347_RS12140 comGB 2423487..2424524 (-) 1038 WP_088613117.1 competence type IV pilus assembly protein ComGB Machinery gene
  OD347_RS12145 comGA 2424511..2425581 (-) 1071 WP_088613118.1 competence type IV pilus ATPase ComGA Machinery gene
  OD347_RS12150 - 2425775..2426725 (-) 951 WP_088613119.1 magnesium transporter CorA family protein -
  OD347_RS12155 - 2426872..2428173 (+) 1302 WP_088613120.1 hemolysin family protein -

Sequence


Protein


Download         Length: 145 a.a.        Molecular weight: 16242.68 Da        Isoelectric Point: 9.7141

>NTDB_id=737952 OD347_RS12130 WP_045510590.1 2422747..2423184(-) (comGD) [Bacillus velezensis strain LT-2]
MNNNRLTENGFTLLESLVVLSLASVLLTVLFTAVPPVYTHLAVRQKTEQLQKDIQLAQETAIAEHKRTKITFLPKEHKYK
LQSAGRIVERSFDSLHITLVTLPESLEFNEKGHPNSGGKIQLKSAGFTYEITVYLGSGNVHAERK

Nucleotide


Download         Length: 438 bp        

>NTDB_id=737952 OD347_RS12130 WP_045510590.1 2422747..2423184(-) (comGD) [Bacillus velezensis strain LT-2]
TTGAACAATAACCGGCTGACAGAAAACGGATTCACCCTTCTTGAAAGCCTGGTTGTGTTAAGTCTGGCGTCTGTATTGCT
GACTGTTTTGTTCACGGCGGTTCCGCCGGTTTATACTCATCTGGCCGTGCGGCAAAAAACAGAACAGCTCCAAAAAGATA
TTCAGCTAGCTCAGGAAACGGCTATCGCAGAACATAAAAGAACAAAAATCACTTTTCTCCCAAAAGAGCATAAATACAAG
CTGCAGTCAGCCGGAAGGATTGTCGAGCGTTCCTTTGATTCGCTTCATATTACACTTGTGACTTTACCGGAGAGCCTTGA
ATTTAACGAAAAAGGCCATCCAAATTCCGGCGGAAAGATTCAATTGAAGAGCGCGGGATTCACTTATGAAATAACAGTTT
ACTTAGGGAGCGGAAATGTCCATGCAGAACGGAAATAA


Secondary structure


Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure


Source ID Structure

Transmembrane helices


Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.



Visualization of predicted probability:


Similar proteins


Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  comGD Bacillus subtilis subsp. subtilis str. 168

56.835

95.862

0.545