Detailed information    

insolico Bioinformatically predicted

Overview

Name   sinI   Type   Regulator
Locus tag   OD347_RS12080 Genome accession   NZ_CP107079
Coordinates   2418130..2418303 (+) Length   57 a.a.
NCBI ID   WP_013352860.1    Uniprot ID   A0A9P1JIA1
Organism   Bacillus velezensis strain LT-2     
Function   inhibit the expression of sinR (predicted from homology)   
Competence regulation

Genomic Context

Location: 2413130..2423303
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  OD347_RS12065 gcvT 2413940..2415040 (-) 1101 WP_088613111.1 glycine cleavage system aminomethyltransferase GcvT -
  OD347_RS12070 - 2415465..2417135 (+) 1671 WP_263687684.1 DEAD/DEAH box helicase -
  OD347_RS12075 - 2417156..2417950 (+) 795 WP_088613113.1 YqhG family protein -
  OD347_RS12080 sinI 2418130..2418303 (+) 174 WP_013352860.1 anti-repressor SinI Regulator
  OD347_RS12085 sinR 2418337..2418672 (+) 336 WP_014470659.1 transcriptional regulator SinR Regulator
  OD347_RS12090 tasA 2418720..2419505 (-) 786 WP_013352862.1 biofilm matrix protein TasA -
  OD347_RS12095 sipW 2419570..2420154 (-) 585 WP_065522773.1 signal peptidase I SipW -
  OD347_RS12100 tapA 2420126..2420797 (-) 672 WP_088613114.1 amyloid fiber anchoring/assembly protein TapA -
  OD347_RS12105 - 2421055..2421384 (+) 330 WP_045510605.1 DUF3889 domain-containing protein -
  OD347_RS12110 - 2421425..2421604 (-) 180 WP_016938971.1 YqzE family protein -
  OD347_RS12115 comGG 2421661..2422038 (-) 378 WP_088613115.1 competence type IV pilus minor pilin ComGG Machinery gene
  OD347_RS12120 comGF 2422040..2422540 (-) 501 WP_235608361.1 competence type IV pilus minor pilin ComGF -
  OD347_RS12125 comGE 2422449..2422763 (-) 315 WP_045510593.1 competence type IV pilus minor pilin ComGE Machinery gene
  OD347_RS12130 comGD 2422747..2423184 (-) 438 WP_045510590.1 competence type IV pilus minor pilin ComGD Machinery gene

Sequence

Protein


Download         Length: 57 a.a.        Molecular weight: 6689.61 Da        Isoelectric Point: 9.8173

>NTDB_id=737948 OD347_RS12080 WP_013352860.1 2418130..2418303(+) (sinI) [Bacillus velezensis strain LT-2]
MKNAKTEFSQLDKEWVELILEAQKANISLEEIRKYLHSHKKSSQHIQAARSHTVNPF

Nucleotide


Download         Length: 174 bp        

>NTDB_id=737948 OD347_RS12080 WP_013352860.1 2418130..2418303(+) (sinI) [Bacillus velezensis strain LT-2]
ATGAAAAATGCAAAAACAGAGTTTTCGCAATTAGATAAGGAATGGGTTGAACTGATATTAGAAGCCCAAAAAGCAAATAT
CAGCCTGGAAGAGATACGCAAATACCTGCATTCGCATAAAAAGTCTTCTCAACATATCCAGGCCGCCAGAAGTCATACCG
TAAATCCTTTCTGA

Domains

Predicted by InterproScan.

Anti-repressor SinI (SinI)

(11-36)


Secondary structure

Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure

Source ID Structure

Transmembrane helices

Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.


Visualization of predicted probability:


Similar proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  sinI Bacillus subtilis subsp. subtilis str. 168

68.421

100

0.684