Detailed information    

insolico Bioinformatically predicted

Overview

Name   degQ   Type   Regulator
Locus tag   ODQ18_RS20565 Genome accession   NZ_CP107039
Coordinates   3991765..3991905 (+) Length   46 a.a.
NCBI ID   WP_003220708.1    Uniprot ID   G4P060
Organism   Bacillus subtilis strain 11060     
Function   modification of regulators (predicted from homology)   
Competence regulation

Genomic Context

Location: 3986765..3996905
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  ODQ18_RS20535 (ODQ18_20535) yueI 3987058..3987456 (+) 399 WP_032726794.1 YueI family protein -
  ODQ18_RS20540 (ODQ18_20540) pncA 3987553..3988104 (+) 552 WP_043940186.1 cysteine hydrolase family protein -
  ODQ18_RS20545 (ODQ18_20545) pncB 3988120..3989592 (+) 1473 WP_003228788.1 nicotinate phosphoribosyltransferase -
  ODQ18_RS20550 (ODQ18_20550) pdeH 3989729..3990958 (+) 1230 WP_003243525.1 cyclic di-GMP phosphodiesterase -
  ODQ18_RS20555 (ODQ18_20555) - 3990934..3991302 (-) 369 WP_041850584.1 hypothetical protein -
  ODQ18_RS20560 (ODQ18_20560) - 3991481..3991543 (-) 63 Protein_3999 hypothetical protein -
  ODQ18_RS20565 (ODQ18_20565) degQ 3991765..3991905 (+) 141 WP_003220708.1 degradation enzyme regulation protein DegQ Regulator
  ODQ18_RS20570 (ODQ18_20570) - 3992089..3992949 (+) 861 WP_041850585.1 polyprenyl synthetase family protein -
  ODQ18_RS20575 (ODQ18_20575) comX 3992962..3993126 (+) 165 WP_015384519.1 competence pheromone ComX -
  ODQ18_RS20580 (ODQ18_20580) - 3993138..3995427 (+) 2290 Protein_4003 histidine kinase -
  ODQ18_RS20585 (ODQ18_20585) comA 3995508..3996152 (+) 645 WP_003220716.1 two-component system response regulator ComA Regulator
  ODQ18_RS20590 (ODQ18_20590) yuxO 3996171..3996551 (+) 381 WP_003228810.1 hotdog fold thioesterase -

Sequence

Protein


Download         Length: 46 a.a.        Molecular weight: 5546.44 Da        Isoelectric Point: 6.2559

>NTDB_id=737681 ODQ18_RS20565 WP_003220708.1 3991765..3991905(+) (degQ) [Bacillus subtilis strain 11060]
MEKKLEEVKQLLFRLELDIKETTDSLRNINKSIDQLDKYNYAMKIS

Nucleotide


Download         Length: 141 bp        

>NTDB_id=737681 ODQ18_RS20565 WP_003220708.1 3991765..3991905(+) (degQ) [Bacillus subtilis strain 11060]
ATGGAAAAGAAACTTGAAGAAGTAAAACAATTGTTATTCCGACTCGAACTTGATATTAAAGAAACGACAGATTCATTACG
AAACATTAACAAAAGCATTGATCAACTCGATAAATACAATTATGCAATGAAAATTTCGTGA

Domains

Predicted by InterproScan.

DegQ (SacQ) family (DegQ)

(1-46)


Secondary structure

Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure

Source ID Structure
  AlphaFold DB G4P060

Transmembrane helices

Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.


Visualization of predicted probability:


Similar proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  degQ Bacillus subtilis subsp. subtilis str. 168

100

100

1