Detailed information    

insolico Bioinformatically predicted

Overview


Name   sinI   Type   Regulator
Locus tag   ODQ18_RS03505 Genome accession   NZ_CP107039
Coordinates   631630..631803 (-) Length   57 a.a.
NCBI ID   WP_003230187.1    Uniprot ID   A0A063X7W9
Organism   Bacillus subtilis strain 11060     
Function   inhibit the expression of sinR (predicted from homology)   
Competence regulation

Genomic Context


Location: 626630..636803
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  ODQ18_RS03460 (ODQ18_03460) comGE 626981..627328 (+) 348 WP_003230165.1 ComG operon protein 5 Machinery gene
  ODQ18_RS03465 (ODQ18_03465) comGF 627354..627737 (+) 384 WP_041850015.1 ComG operon protein ComGF Machinery gene
  ODQ18_RS03470 (ODQ18_03470) comGG 627738..628112 (+) 375 WP_015251714.1 ComG operon protein ComGG Machinery gene
  ODQ18_RS03475 (ODQ18_03475) spoIITA 628183..628362 (+) 180 WP_003230176.1 YqzE family protein -
  ODQ18_RS03480 (ODQ18_03480) yqzG 628404..628730 (-) 327 WP_003246051.1 YqzG/YhdC family protein -
  ODQ18_RS03485 (ODQ18_03485) tapA 629002..629763 (+) 762 WP_015251716.1 amyloid fiber anchoring/assembly protein TapA -
  ODQ18_RS03490 (ODQ18_03490) sipW 629747..630319 (+) 573 WP_003246088.1 signal peptidase I SipW -
  ODQ18_RS03495 (ODQ18_03495) tasA 630383..631168 (+) 786 WP_015251717.1 biofilm matrix protein TasA -
  ODQ18_RS03500 (ODQ18_03500) sinR 631261..631596 (-) 336 WP_003226345.1 transcriptional regulator SinR Regulator
  ODQ18_RS03505 (ODQ18_03505) sinI 631630..631803 (-) 174 WP_003230187.1 anti-repressor SinI Regulator
  ODQ18_RS03510 (ODQ18_03510) yqhG 631986..632780 (-) 795 WP_003230200.1 YqhG family protein -
  ODQ18_RS03515 (ODQ18_03515) hepAA 632801..634474 (-) 1674 WP_041850014.1 DEAD/DEAH box helicase -
  ODQ18_RS03520 (ODQ18_03520) gcvT 634915..636003 (+) 1089 WP_041850013.1 glycine cleavage system aminomethyltransferase GcvT -

Sequence


Protein


Download         Length: 57 a.a.        Molecular weight: 6601.52 Da        Isoelectric Point: 6.7231

>NTDB_id=737626 ODQ18_RS03505 WP_003230187.1 631630..631803(-) (sinI) [Bacillus subtilis strain 11060]
MKNAKQEHFELDQEWVELMVEAKEANISPEEIRKYLLLNKKSAHPGPAARSHTVNPF

Nucleotide


Download         Length: 174 bp        

>NTDB_id=737626 ODQ18_RS03505 WP_003230187.1 631630..631803(-) (sinI) [Bacillus subtilis strain 11060]
ATGAAGAATGCAAAACAAGAGCACTTTGAATTGGATCAAGAATGGGTTGAATTAATGGTGGAAGCCAAAGAGGCAAATAT
CAGCCCGGAAGAAATACGAAAATATTTACTTTTAAACAAAAAGTCTGCTCATCCTGGTCCGGCAGCCAGAAGTCATACCG
TAAATCCTTTCTGA

Domains


Predicted by InterproScan.

(11-36)


Secondary structure


Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure


Source ID Structure
  AlphaFold DB A0A063X7W9

Transmembrane helices


Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.



Visualization of predicted probability:


Similar proteins


Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  sinI Bacillus subtilis subsp. subtilis str. 168

100

100

1