Detailed information    

insolico Bioinformatically predicted

Overview

Name   dprA   Type   Machinery gene
Locus tag   FNL83_RS07805 Genome accession   NZ_AP019721
Coordinates   1606688..1607560 (-) Length   290 a.a.
NCBI ID   WP_001829468.1    Uniprot ID   -
Organism   Staphylococcus epidermidis strain NBRC 100911     
Function   ssDNA binding; loading RecA onto ssDNA (predicted from homology)   
DNA processing

Related MGE

Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.

Gene-MGE association summary

MGE type MGE coordinates Gene coordinates Relative position Distance (bp)
ICE 1568228..1639041 1606688..1607560 within 0


Gene organization within MGE regions


Location: 1568228..1639041
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  FNL83_RS07660 (Sep02g_14310) yfmF 1569268..1570539 (-) 1272 WP_002439538.1 EF-P 5-aminopentanol modification-associated protein YfmF -
  FNL83_RS07665 (Sep02g_14320) - 1570570..1571283 (-) 714 WP_002439536.1 GntR family transcriptional regulator -
  FNL83_RS07670 (Sep02g_14330) - 1571286..1573679 (-) 2394 WP_002439534.1 DNA translocase FtsK -
  FNL83_RS07675 (Sep02g_14340) rnjB 1573945..1575618 (-) 1674 WP_002457357.1 ribonuclease J2 -
  FNL83_RS07680 (Sep02g_14350) pnp 1575986..1578091 (-) 2106 WP_001832554.1 polyribonucleotide nucleotidyltransferase -
  FNL83_RS07685 (Sep02g_14360) rpsO 1578223..1578492 (-) 270 WP_002439528.1 30S ribosomal protein S15 -
  FNL83_RS07690 (Sep02g_14370) - 1578612..1579583 (-) 972 WP_001832563.1 bifunctional riboflavin kinase/FAD synthetase -
  FNL83_RS07695 (Sep02g_14380) truB 1579599..1580516 (-) 918 WP_002456563.1 tRNA pseudouridine(55) synthase TruB -
  FNL83_RS07700 (Sep02g_14390) rbfA 1580654..1581004 (-) 351 WP_001829509.1 30S ribosome-binding factor RbfA -
  FNL83_RS07705 (Sep02g_14400) infB 1581307..1583469 (-) 2163 WP_002468903.1 translation initiation factor IF-2 -
  FNL83_RS07710 (Sep02g_14410) - 1583474..1583791 (-) 318 WP_002439520.1 YlxQ family RNA-binding protein -
  FNL83_RS07715 (Sep02g_14420) rnpM 1583791..1584075 (-) 285 WP_001829465.1 RNase P modulator RnpM -
  FNL83_RS07720 (Sep02g_14430) nusA 1584093..1585316 (-) 1224 WP_002456565.1 transcription termination factor NusA -
  FNL83_RS07725 (Sep02g_14440) rimP 1585337..1585804 (-) 468 WP_002439519.1 ribosome maturation factor RimP -
  FNL83_RS07730 (Sep02g_14450) - 1585983..1590293 (-) 4311 WP_002456566.1 PolC-type DNA polymerase III -
  FNL83_RS07735 (Sep02g_14460) - 1590543..1592246 (-) 1704 WP_001829513.1 proline--tRNA ligase -
  FNL83_RS07740 (Sep02g_14470) rseP 1592265..1593551 (-) 1287 WP_001829501.1 RIP metalloprotease RseP -
  FNL83_RS07745 (Sep02g_14480) - 1593785..1594567 (-) 783 WP_001829499.1 phosphatidate cytidylyltransferase -
  FNL83_RS07750 (Sep02g_14500) - 1594571..1595341 (-) 771 WP_001832561.1 isoprenyl transferase -
  FNL83_RS07755 (Sep02g_14510) frr 1595562..1596116 (-) 555 WP_001829472.1 ribosome recycling factor -
  FNL83_RS07760 (Sep02g_14520) pyrH 1596133..1596855 (-) 723 WP_002439511.1 UMP kinase -
  FNL83_RS07765 (Sep02g_14530) tsf 1596996..1597874 (-) 879 WP_002439509.1 translation elongation factor Ts -
  FNL83_RS07770 (Sep02g_14540) rpsB 1598026..1598814 (-) 789 WP_001832557.1 30S ribosomal protein S2 -
  FNL83_RS07775 (Sep02g_14550) codY 1599177..1599947 (-) 771 WP_002439506.1 GTP-sensing pleiotropic transcriptional regulator CodY -
  FNL83_RS07780 (Sep02g_14560) hslU 1599971..1601374 (-) 1404 WP_001829474.1 ATP-dependent protease ATPase subunit HslU -
  FNL83_RS07785 (Sep02g_14570) hslV 1601443..1601985 (-) 543 WP_001829498.1 ATP-dependent protease subunit HslV -
  FNL83_RS07790 (Sep02g_14580) xerC 1601989..1602849 (-) 861 WP_002439503.1 tyrosine recombinase XerC -
  FNL83_RS07795 (Sep02g_14590) trmFO 1603104..1604411 (-) 1308 WP_001832560.1 FADH(2)-oxidizing methylenetetrahydrofolate--tRNA-(uracil(54)-C(5))- methyltransferase TrmFO -
  FNL83_RS07800 (Sep02g_14600) topA 1604436..1606505 (-) 2070 WP_002489763.1 type I DNA topoisomerase -
  FNL83_RS07805 (Sep02g_14610) dprA 1606688..1607560 (-) 873 WP_001829468.1 DNA-processing protein DprA Machinery gene
  FNL83_RS07810 (Sep02g_14620) sucD 1608366..1609274 (-) 909 WP_002446283.1 succinate--CoA ligase subunit alpha -
  FNL83_RS07815 (Sep02g_14630) sucC 1609296..1610462 (-) 1167 WP_002439496.1 ADP-forming succinate--CoA ligase subunit beta -
  FNL83_RS07820 (Sep02g_14640) - 1610570..1611340 (-) 771 WP_001829514.1 ribonuclease HII -
  FNL83_RS07825 (Sep02g_14650) ylqF 1611345..1612208 (-) 864 WP_001829495.1 ribosome biogenesis GTPase YlqF -
  FNL83_RS07835 (Sep02g_14670) - 1612537..1615137 (+) 2601 WP_002468914.1 YfhO family protein -
  FNL83_RS07840 (Sep02g_14680) - 1615130..1617733 (+) 2604 WP_002470232.1 YfhO family protein -
  FNL83_RS07845 (Sep02g_14690) rplS 1618263..1618613 (-) 351 WP_054828570.1 50S ribosomal protein L19 -
  FNL83_RS07850 (Sep02g_14700) trmD 1618719..1619456 (-) 738 WP_001829466.1 tRNA (guanosine(37)-N1)-methyltransferase TrmD -
  FNL83_RS07855 (Sep02g_14710) rimM 1619456..1619959 (-) 504 WP_001832559.1 ribosome maturation factor RimM -
  FNL83_RS07860 (Sep02g_14720) rpsP 1620086..1620361 (-) 276 WP_002439483.1 30S ribosomal protein S16 -
  FNL83_RS07865 (Sep02g_14730) ffh 1620607..1621974 (-) 1368 WP_001830113.1 signal recognition particle protein -
  FNL83_RS07870 (Sep02g_14740) - 1622005..1622337 (-) 333 WP_002457379.1 putative DNA-binding protein -
  FNL83_RS07875 (Sep02g_14750) ftsY 1622339..1623565 (-) 1227 WP_001830080.1 signal recognition particle-docking protein FtsY -
  FNL83_RS07880 (Sep02g_14760) smc 1623562..1627131 (-) 3570 WP_002468549.1 chromosome segregation protein SMC -
  FNL83_RS07885 (Sep02g_14770) rnc 1627258..1627995 (-) 738 WP_002470220.1 ribonuclease III -
  FNL83_RS07890 (Sep02g_14780) - 1628110..1628343 (-) 234 WP_001830184.1 acyl carrier protein -
  FNL83_RS07895 (Sep02g_14790) fabG 1628570..1629304 (-) 735 WP_001830161.1 3-oxoacyl-[acyl-carrier-protein] reductase -
  FNL83_RS07900 (Sep02g_14800) fabD 1629297..1630223 (-) 927 WP_002489765.1 ACP S-malonyltransferase -
  FNL83_RS07905 (Sep02g_14810) plsX 1630225..1631202 (-) 978 WP_001830112.1 phosphate acyltransferase PlsX -
  FNL83_RS07910 (Sep02g_14820) fapR 1631204..1631764 (-) 561 WP_001830099.1 transcription factor FapR -
  FNL83_RS07915 (Sep02g_14830) recG 1631923..1633971 (-) 2049 WP_001830069.1 ATP-dependent DNA helicase RecG -
  FNL83_RS07920 (Sep02g_14840) fakA 1634175..1635833 (-) 1659 WP_001830116.1 fatty acid kinase catalytic subunit FakA -
  FNL83_RS07925 (Sep02g_14850) - 1635848..1636222 (-) 375 WP_001830156.1 Asp23/Gls24 family envelope stress response protein -
  FNL83_RS07930 (Sep02g_14860) rpmB 1636580..1636768 (+) 189 WP_001830107.1 50S ribosomal protein L28 -
  FNL83_RS07935 (Sep02g_14870) - 1636851..1637486 (-) 636 WP_001830164.1 thiamine diphosphokinase -
  FNL83_RS07940 (Sep02g_14880) rpe 1637491..1638135 (-) 645 WP_001830173.1 ribulose-phosphate 3-epimerase -
  FNL83_RS07945 (Sep02g_14890) rsgA 1638136..1639011 (-) 876 WP_001830137.1 ribosome small subunit-dependent GTPase A -

Sequence

Protein


Download         Length: 290 a.a.        Molecular weight: 33726.62 Da        Isoelectric Point: 9.3618

>NTDB_id=73589 FNL83_RS07805 WP_001829468.1 1606688..1607560(-) (dprA) [Staphylococcus epidermidis strain NBRC 100911]
MIQHTMLKLYWANFTTAQLHHLTSTYPDFLSENVFHQHDMIKRWLTERNSERLWNKYERFKELKLMDIIKEMKKANVSFT
TYFDDNYPSLCKEMYDYPYVIFYKGNPQFFNHSHSLAVIGSRNATQYTSQSLNYLFPSFRQLNMAIVSGLARGADSVAHQ
TALKYLLPTIGVLGFGHCYHYPKATLNLRTKVERNGLVISEYPPFSPISKHKFPERNRLISGLSRGVLITEAEERSGSQI
TIDCALEQNRNVYVLPGSMFNKMTKGNLRRINEGAQVVIDESSILYDYLF

Nucleotide


Download         Length: 873 bp        

>NTDB_id=73589 FNL83_RS07805 WP_001829468.1 1606688..1607560(-) (dprA) [Staphylococcus epidermidis strain NBRC 100911]
TTGATACAACATACGATGTTAAAACTATATTGGGCAAATTTCACTACGGCACAACTTCATCATCTTACAAGTACATATCC
TGACTTTCTATCAGAAAACGTATTTCATCAACATGACATGATAAAAAGGTGGCTTACAGAGCGTAATTCTGAAAGGCTAT
GGAACAAATATGAACGTTTCAAAGAATTAAAGCTGATGGACATTATTAAAGAAATGAAAAAAGCAAATGTTAGTTTTACA
ACATACTTTGATGATAACTACCCTTCTCTTTGCAAAGAAATGTATGATTATCCTTATGTGATATTCTACAAAGGAAATCC
ACAGTTCTTTAATCATTCTCACTCTTTAGCTGTAATTGGCTCACGTAATGCCACACAATATACAAGTCAATCTTTAAACT
ATCTTTTTCCTTCATTTAGACAATTAAATATGGCGATTGTTTCTGGATTAGCGCGCGGTGCAGATAGTGTAGCACATCAA
ACCGCACTTAAATACCTATTACCAACTATTGGCGTACTTGGATTTGGCCATTGTTATCATTATCCTAAAGCAACCTTAAA
TTTAAGAACTAAAGTTGAAAGGAATGGCTTAGTGATAAGTGAATATCCACCATTTTCTCCTATAAGTAAGCATAAATTTC
CTGAAAGAAACAGGCTTATAAGTGGTCTGTCCAGAGGGGTACTTATAACTGAGGCTGAAGAAAGAAGTGGTAGTCAAATC
ACTATCGATTGTGCTTTAGAGCAAAATAGAAATGTTTATGTTCTACCTGGTTCAATGTTCAACAAAATGACTAAAGGTAA
TTTAAGAAGGATAAATGAAGGTGCTCAAGTTGTTATAGATGAAAGTAGTATATTATATGATTATCTATTTTAG

Domains

Predicted by InterproScan.

DNA recombination-mediator protein A (DNA_processg_A)

(72-279)


Secondary structure

Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure

Source ID Structure

Transmembrane helices

Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.


Visualization of predicted probability:


Similar proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  dprA Staphylococcus aureus N315

56.944

99.31

0.566
  dprA Staphylococcus aureus MW2

56.944

99.31

0.566

Multiple sequence alignment