Detailed information    

insolico Bioinformatically predicted

Overview


Name   pilL   Type   Machinery gene
Locus tag   NDQ80_RS02355 Genome accession   NZ_CP106821
Coordinates   454162..454635 (+) Length   157 a.a.
NCBI ID   WP_172760650.1    Uniprot ID   -
Organism   Neisseria gonorrhoeae strain 10529     
Function   type IV pilus (predicted from homology)   
DNA binding and uptake

Related MGE


Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.

Gene-MGE association summary

MGE type MGE coordinates Gene coordinates Relative position Distance (bp)
Prophage 444489..506109 454162..454635 within 0


Gene organization within MGE regions


Location: 444489..506109
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  NDQ80_RS02300 (NDQ80_02305) - 444489..445565 (-) 1077 WP_003692814.1 sulfate/molybdate ABC transporter ATP-binding protein -
  NDQ80_RS02305 (NDQ80_02310) cysW 445562..446422 (-) 861 WP_003699617.1 sulfate ABC transporter permease subunit CysW -
  NDQ80_RS02310 (NDQ80_02315) cysT 446611..447438 (-) 828 WP_003699619.1 sulfate ABC transporter permease subunit CysT -
  NDQ80_RS02315 (NDQ80_02320) - 447619..447951 (+) 333 WP_003687908.1 hypothetical protein -
  NDQ80_RS02320 (NDQ80_02325) - 448278..448787 (+) 510 WP_003687909.1 isoprenylcysteine carboxyl methyltransferase family protein -
  NDQ80_RS02325 (NDQ80_02330) - 449019..449600 (-) 582 WP_003690895.1 superoxide dismutase -
  NDQ80_RS02330 (NDQ80_02335) dnaB 449764..451170 (+) 1407 WP_003699622.1 replicative DNA helicase -
  NDQ80_RS02335 (NDQ80_02340) pilH 451324..451989 (+) 666 WP_003699624.1 Tfp pilus assembly protein FimT/FimU Machinery gene
  NDQ80_RS02340 (NDQ80_02345) pilV 452021..452632 (+) 612 WP_003699626.1 type IV pilus modification protein PilV Machinery gene
  NDQ80_RS02345 (NDQ80_02350) pilJ 452629..453570 (+) 942 WP_047920195.1 PilW family protein Machinery gene
  NDQ80_RS02350 (NDQ80_02355) pilK 453549..454160 (+) 612 WP_033911077.1 PilX N-terminal domain-containing pilus assembly protein Machinery gene
  NDQ80_RS02355 (NDQ80_02360) pilL 454162..454635 (+) 474 WP_172760650.1 PilX family type IV pilin Machinery gene
  NDQ80_RS02360 (NDQ80_02365) - 454705..455013 (-) 309 WP_025456177.1 AzlD family protein -
  NDQ80_RS02365 (NDQ80_02370) - 455010..455720 (-) 711 Protein_464 AzlC family ABC transporter permease -
  NDQ80_RS02370 (NDQ80_02375) dut 455886..456338 (+) 453 WP_003699637.1 dUTP diphosphatase -
  NDQ80_RS02375 (NDQ80_02380) dapC 456414..457601 (+) 1188 WP_003699639.1 succinyldiaminopimelate transaminase -
  NDQ80_RS02380 (NDQ80_02385) yaaA 457757..458536 (+) 780 WP_003699641.1 peroxide stress protein YaaA -
  NDQ80_RS02395 (NDQ80_02400) - 459066..460258 (+) 1193 Protein_468 tyrosine-type recombinase/integrase -
  NDQ80_RS02400 (NDQ80_02405) - 460614..460883 (-) 270 WP_003687928.1 hypothetical protein -
  NDQ80_RS02405 (NDQ80_02410) - 461078..461761 (-) 684 WP_003687929.1 DUF2786 domain-containing protein -
  NDQ80_RS11985 - 462042..462308 (-) 267 Protein_471 hypothetical protein -
  NDQ80_RS02415 (NDQ80_02420) - 462419..462634 (-) 216 WP_003691538.1 hypothetical protein -
  NDQ80_RS02420 (NDQ80_02425) - 462686..463177 (-) 492 WP_033911206.1 siphovirus Gp157 family protein -
  NDQ80_RS02425 (NDQ80_02430) - 463174..463356 (-) 183 WP_003691535.1 hypothetical protein -
  NDQ80_RS02430 (NDQ80_02435) - 463496..464182 (-) 687 WP_010357532.1 phage replication initiation protein, NGO0469 family -
  NDQ80_RS02435 (NDQ80_02440) - 464251..464412 (-) 162 WP_003691530.1 hypothetical protein -
  NDQ80_RS02440 (NDQ80_02445) - 464409..464684 (-) 276 WP_033911205.1 NGO1622 family putative holin -
  NDQ80_RS02445 (NDQ80_02450) - 464837..465169 (-) 333 WP_003695500.1 hypothetical protein -
  NDQ80_RS02450 (NDQ80_02455) - 465311..465601 (-) 291 WP_260244382.1 hypothetical protein -
  NDQ80_RS02455 (NDQ80_02460) - 465598..466074 (-) 477 WP_002255718.1 DUF6948 domain-containing protein -
  NDQ80_RS02460 (NDQ80_02465) - 466107..466307 (-) 201 WP_003692842.1 hypothetical protein -
  NDQ80_RS02465 (NDQ80_02470) - 466791..467009 (+) 219 WP_003691731.1 hypothetical protein -
  NDQ80_RS02470 (NDQ80_02475) - 467026..467385 (-) 360 WP_003691733.1 hypothetical protein -
  NDQ80_RS02475 (NDQ80_02480) - 467386..467925 (-) 540 WP_003695998.1 Panacea domain-containing protein -
  NDQ80_RS02480 (NDQ80_02485) - 468085..468801 (-) 717 WP_003695999.1 helix-turn-helix transcriptional regulator -
  NDQ80_RS02485 (NDQ80_02490) - 469182..469409 (+) 228 WP_003698261.1 helix-turn-helix domain-containing protein -
  NDQ80_RS02490 (NDQ80_02495) - 469527..470591 (+) 1065 WP_003689134.1 hypothetical protein -
  NDQ80_RS02495 (NDQ80_02500) - 470588..471949 (+) 1362 WP_003700074.1 DnaB-like helicase C-terminal domain-containing protein -
  NDQ80_RS02500 (NDQ80_02505) - 471966..472217 (+) 252 WP_003693465.1 hypothetical protein -
  NDQ80_RS02505 (NDQ80_02510) - 472231..472725 (+) 495 WP_003691434.1 DUF3310 domain-containing protein -
  NDQ80_RS02510 (NDQ80_02515) - 472902..473051 (+) 150 WP_033911232.1 phage associated protein -
  NDQ80_RS02515 (NDQ80_02520) - 473079..473360 (+) 282 WP_003689109.1 hypothetical protein -
  NDQ80_RS02520 (NDQ80_02525) - 473351..473731 (+) 381 WP_033910829.1 RusA family crossover junction endodeoxyribonuclease -
  NDQ80_RS02525 (NDQ80_02530) - 473748..473876 (-) 129 WP_012503747.1 hypothetical protein -
  NDQ80_RS02530 (NDQ80_02535) - 473998..474405 (+) 408 WP_003691430.1 hypothetical protein -
  NDQ80_RS02535 (NDQ80_02540) - 474496..475656 (+) 1161 WP_003691428.1 type I restriction endonuclease -
  NDQ80_RS02540 (NDQ80_02545) - 475938..476807 (+) 870 WP_003700071.1 BRO family protein -
  NDQ80_RS02545 (NDQ80_02550) - 477100..477549 (+) 450 WP_003689093.1 hypothetical protein -
  NDQ80_RS02550 (NDQ80_02555) terL 477611..479032 (+) 1422 WP_003697216.1 phage terminase large subunit -
  NDQ80_RS02555 (NDQ80_02560) - 479029..481176 (+) 2148 WP_003691423.1 phage portal protein -
  NDQ80_RS02560 (NDQ80_02565) - 481244..482401 (+) 1158 WP_260244383.1 caudovirus prohead protease -
  NDQ80_RS02565 (NDQ80_02570) - 482442..483941 (+) 1500 WP_003691419.1 hypothetical protein -
  NDQ80_RS02570 (NDQ80_02575) - 483948..484310 (+) 363 WP_003689082.1 hypothetical protein -
  NDQ80_RS02575 (NDQ80_02580) - 484313..484843 (+) 531 WP_003689080.1 head-tail connector protein -
  NDQ80_RS02580 (NDQ80_02585) - 484843..485325 (+) 483 WP_003706029.1 HK97 gp10 family phage protein -
  NDQ80_RS02585 (NDQ80_02590) - 485322..485750 (+) 429 WP_003697213.1 hypothetical protein -
  NDQ80_RS02590 (NDQ80_02595) - 485776..486549 (+) 774 WP_003691416.1 hypothetical protein -
  NDQ80_RS02595 (NDQ80_02600) - 486610..486939 (+) 330 WP_003689072.1 hypothetical protein -
  NDQ80_RS02600 (NDQ80_02605) - 486951..487217 (+) 267 WP_003689070.1 hypothetical protein -
  NDQ80_RS02605 (NDQ80_02610) - 487217..487816 (+) 600 WP_003692874.1 DUF2460 domain-containing protein -
  NDQ80_RS02610 (NDQ80_02615) - 487813..488667 (+) 855 WP_010357642.1 DUF2163 domain-containing protein -
  NDQ80_RS02615 (NDQ80_02620) - 488669..489100 (+) 432 WP_003689064.1 NlpC/P60 family protein -
  NDQ80_RS02620 (NDQ80_02625) - 489128..489406 (-) 279 WP_003692877.1 helix-turn-helix domain-containing protein -
  NDQ80_RS02625 (NDQ80_02630) - 489646..493791 (+) 4146 WP_146714070.1 phage tail protein -
  NDQ80_RS02630 (NDQ80_02635) - 493903..494208 (+) 306 WP_047917725.1 hypothetical protein -
  NDQ80_RS02635 (NDQ80_02640) - 494279..494749 (+) 471 WP_003691410.1 hypothetical protein -
  NDQ80_RS02640 (NDQ80_02645) - 494750..495082 (+) 333 WP_003691408.1 hypothetical protein -
  NDQ80_RS02645 (NDQ80_02655) - 495436..495783 (-) 348 WP_003689051.1 type II toxin-antitoxin system PemK/MazF family toxin -
  NDQ80_RS02650 (NDQ80_02660) - 495783..496019 (-) 237 WP_003689049.1 AbrB/MazE/SpoVT family DNA-binding domain-containing protein -
  NDQ80_RS02655 (NDQ80_02665) - 496059..496184 (+) 126 WP_255294325.1 hypothetical protein -
  NDQ80_RS02660 (NDQ80_02670) - 496226..496765 (+) 540 WP_260244384.1 TIGR02594 family protein -
  NDQ80_RS02665 (NDQ80_02675) - 496765..496923 (+) 159 WP_003691816.1 hypothetical protein -
  NDQ80_RS02670 (NDQ80_02680) - 496907..497248 (+) 342 WP_003696082.1 hypothetical protein -
  NDQ80_RS02675 (NDQ80_02685) - 497232..497405 (+) 174 WP_017146757.1 hypothetical protein -
  NDQ80_RS02680 (NDQ80_02690) - 497717..497866 (+) 150 WP_003691402.1 hypothetical protein -
  NDQ80_RS02685 (NDQ80_02695) - 497896..500943 (+) 3048 WP_260244385.1 tape measure protein -
  NDQ80_RS02690 (NDQ80_02700) - 501003..501482 (-) 480 WP_002241413.1 DUF4760 domain-containing protein -
  NDQ80_RS02695 (NDQ80_02705) - 501824..502813 (-) 990 WP_003689040.1 site-specific integrase -
  NDQ80_RS02700 (NDQ80_02710) - 503073..503261 (-) 189 WP_003689039.1 hypothetical protein -
  NDQ80_RS02705 (NDQ80_02715) purM 503502..504536 (+) 1035 WP_003692893.1 phosphoribosylformylglycinamidine cyclo-ligase -

Sequence


Protein


Download         Length: 157 a.a.        Molecular weight: 17429.25 Da        Isoelectric Point: 9.7225

>NTDB_id=735810 NDQ80_RS02355 WP_172760650.1 454162..454635(+) (pilL) [Neisseria gonorrhoeae strain 10529]
MEQKGFTLIEMMIVVAILGIISVIAIPSYQSYIEKGYQSQLYTEMVGINNVLKQFILKNPLDDNQTIKTKLEIFVSGYKM
NPKIAKKYSVSVAFANTEKPRVYRLVGVPKAGTGYTLSVWMNSVGDGYKCRDAASAQAYSETLSANTGCEAFSNRKK

Nucleotide


Download         Length: 474 bp        

>NTDB_id=735810 NDQ80_RS02355 WP_172760650.1 454162..454635(+) (pilL) [Neisseria gonorrhoeae strain 10529]
ATGGAACAAAAAGGGTTTACATTGATTGAGATGATGATAGTTGTCGCGATACTCGGCATTATCAGCGTCATTGCCATACC
TTCTTATCAAAGTTATATTGAAAAAGGCTATCAGTCCCAGCTTTATACGGAGATGGTCGGTATCAACAATGTTCTCAAAC
AGTTTATTTTGAAAAATCCCCTGGACGATAATCAGACCATCAAGACCAAACTGGAAATATTTGTCTCAGGCTATAAGATG
AATCCGAAAATTGCCAAAAAATATAGTGTTTCGGTGGCATTTGCCAATACGGAAAAACCAAGGGTATACAGGTTGGTCGG
CGTTCCGAAGGCAGGGACGGGTTATACCTTGTCGGTATGGATGAACAGCGTGGGCGACGGATACAAATGCCGTGATGCCG
CTTCTGCCCAGGCCTATTCGGAGACCTTGTCCGCAAATACCGGCTGTGAAGCTTTCTCTAATCGTAAAAAATAG


Secondary structure


Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure


Source ID Structure

Transmembrane helices


Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.



Visualization of predicted probability:


Similar proteins


Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  pilL Neisseria gonorrhoeae MS11

91.083

100

0.911

  pilX Neisseria meningitidis 8013

88.535

100

0.885