Detailed information    

insolico Bioinformatically predicted

Overview

Name   pilC   Type   Machinery gene
Locus tag   OCL46_RS11755 Genome accession   NZ_CP106811
Coordinates   55719..55841 (-) Length   40 a.a.
NCBI ID   WP_317629301.1    Uniprot ID   -
Organism   Neisseria gonorrhoeae strain 10531     
Function   assembly of type IV pilus (predicted from homology)   
DNA binding and uptake

Related MGE

Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.

Gene-MGE association summary

MGE type MGE coordinates Gene coordinates Relative position Distance (bp)
Genomic island 38582..56681 55719..55841 within 0


Gene organization within MGE regions


Location: 38582..56681
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  OCL46_RS00205 (OCL46_00205) orn 38961..39524 (-) 564 WP_003687260.1 oligoribonuclease -
  OCL46_RS00210 (OCL46_00210) prmA 39542..40429 (-) 888 WP_003692488.1 50S ribosomal protein L11 methyltransferase -
  OCL46_RS00215 (OCL46_00215) accC 40533..41894 (-) 1362 WP_033911172.1 acetyl-CoA carboxylase biotin carboxylase subunit -
  OCL46_RS00220 (OCL46_00220) accB 42008..42469 (-) 462 WP_003687267.1 acetyl-CoA carboxylase biotin carboxyl carrier protein -
  OCL46_RS00225 (OCL46_00225) - 42451..42708 (-) 258 WP_003687268.1 hypothetical protein -
  OCL46_RS00230 (OCL46_00230) queA 42825..43865 (+) 1041 WP_003687270.1 tRNA preQ1(34) S-adenosylmethionine ribosyltransferase-isomerase QueA -
  OCL46_RS00235 (OCL46_00235) carB 44066..47281 (-) 3216 WP_003699430.1 carbamoyl-phosphate synthase large subunit -
  OCL46_RS00240 (OCL46_00240) - 47292..47825 (-) 534 WP_003692498.1 hypothetical protein -
  OCL46_RS00245 (OCL46_00245) - 49108..49497 (-) 390 WP_003687278.1 endonuclease domain-containing protein -
  OCL46_RS00255 (OCL46_00255) - 49660..50039 (-) 380 Protein_48 VOC family protein -
  OCL46_RS00260 (OCL46_00260) carA 50093..51226 (-) 1134 WP_003699436.1 glutamine-hydrolyzing carbamoyl-phosphate synthase small subunit -
  OCL46_RS00265 (OCL46_00265) pilC 52720..55719 (-) 3000 WP_317629300.1 PilC family type IV pilus tip adhesin Machinery gene
  OCL46_RS11755 pilC 55719..55841 (-) 123 WP_317629301.1 hypothetical protein Machinery gene

Sequence

Protein


Download         Length: 40 a.a.        Molecular weight: 4797.77 Da        Isoelectric Point: 13.0490

>NTDB_id=735602 OCL46_RS11755 WP_317629301.1 55719..55841(-) (pilC) [Neisseria gonorrhoeae strain 10531]
MNKTLKRRVFRHTALYAAILMFSHTGGRGRRRRKRINTLL

Nucleotide


Download         Length: 123 bp        

>NTDB_id=735602 OCL46_RS11755 WP_317629301.1 55719..55841(-) (pilC) [Neisseria gonorrhoeae strain 10531]
ATGAATAAAACTTTAAAAAGGCGGGTTTTCCGCCATACCGCGCTTTATGCCGCCATCTTGATGTTTTCCCATACCGGCGG
GCGGGGCAGGCGCAGGCGCAAACGTATAAATACGCTATTGTGA

Domains


No domain identified.



Secondary structure

Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure

Source ID Structure

Transmembrane helices

Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.


Visualization of predicted probability:


Similar proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  pilC Neisseria meningitidis A1493

93.103

72.5

0.675