Detailed information    

insolico Bioinformatically predicted

Overview

Name   pilL   Type   Machinery gene
Locus tag   OCL39_RS05970 Genome accession   NZ_CP106805
Coordinates   1154958..1155431 (-) Length   157 a.a.
NCBI ID   WP_260237126.1    Uniprot ID   -
Organism   Neisseria gonorrhoeae strain 10743     
Function   type IV pilus (predicted from homology)   
DNA binding and uptake

Related MGE

Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.

Gene-MGE association summary

MGE type MGE coordinates Gene coordinates Relative position Distance (bp)
Prophage 1109951..1165419 1154958..1155431 within 0


Gene organization within MGE regions


Location: 1109951..1165419
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  OCL39_RS05695 (OCL39_05695) - 1109951..1110802 (+) 852 WP_106336892.1 Bro-N domain-containing protein -
  OCL39_RS05700 (OCL39_05700) - 1110839..1110988 (-) 150 WP_017146863.1 hypothetical protein -
  OCL39_RS05705 (OCL39_05705) - 1110991..1111665 (-) 675 WP_003693436.1 hypothetical protein -
  OCL39_RS05710 (OCL39_05710) - 1111662..1112147 (-) 486 WP_003693438.1 hypothetical protein -
  OCL39_RS05715 (OCL39_05715) - 1112153..1112626 (-) 474 WP_003693439.1 hypothetical protein -
  OCL39_RS05720 (OCL39_05720) - 1112685..1113980 (-) 1296 Protein_1099 DUF4043 family protein -
  OCL39_RS05730 (OCL39_05730) - 1114001..1114900 (-) 900 WP_260236904.1 hypothetical protein -
  OCL39_RS05735 (OCL39_05735) - 1114985..1116178 (-) 1194 WP_134921505.1 hypothetical protein -
  OCL39_RS05740 (OCL39_05740) - 1116166..1119372 (-) 3207 WP_260245440.1 hypothetical protein -
  OCL39_RS05745 (OCL39_05745) - 1119375..1119755 (-) 381 WP_082298757.1 hypothetical protein -
  OCL39_RS05750 (OCL39_05750) - 1119755..1120642 (-) 888 WP_082298758.1 hypothetical protein -
  OCL39_RS05755 (OCL39_05755) - 1120635..1121060 (-) 426 WP_106336882.1 hypothetical protein -
  OCL39_RS05760 (OCL39_05760) - 1121071..1121478 (-) 408 WP_082298808.1 hypothetical protein -
  OCL39_RS05765 (OCL39_05765) - 1121576..1129342 (-) 7767 WP_263055812.1 PLxRFG domain-containing protein -
  OCL39_RS05770 (OCL39_05770) - 1129339..1130013 (-) 675 WP_260236901.1 hypothetical protein -
  OCL39_RS05775 (OCL39_05775) - 1130010..1130534 (-) 525 WP_260236900.1 hypothetical protein -
  OCL39_RS05780 (OCL39_05780) - 1130774..1133041 (-) 2268 WP_225577699.1 hypothetical protein -
  OCL39_RS05785 (OCL39_05785) - 1133026..1134300 (-) 1275 WP_311201960.1 PBSX family phage terminase large subunit -
  OCL39_RS05790 (OCL39_05790) - 1134281..1134820 (-) 540 WP_003693457.1 hypothetical protein -
  OCL39_RS05795 (OCL39_05795) - 1134820..1135242 (-) 423 WP_003690919.1 hypothetical protein -
  OCL39_RS05800 (OCL39_05800) - 1135307..1135825 (-) 519 WP_003687984.1 HNH endonuclease -
  OCL39_RS05805 (OCL39_05805) - 1135816..1136199 (-) 384 WP_003687982.1 recombination protein NinB -
  OCL39_RS05810 (OCL39_05810) - 1136196..1136501 (-) 306 WP_053015205.1 DUF1364 domain-containing protein -
  OCL39_RS05815 (OCL39_05815) - 1136494..1136928 (-) 435 WP_260245439.1 RusA family crossover junction endodeoxyribonuclease -
  OCL39_RS05820 (OCL39_05820) - 1136919..1137200 (-) 282 WP_229691900.1 hypothetical protein -
  OCL39_RS05825 (OCL39_05825) - 1137229..1137378 (-) 150 WP_003692854.1 hypothetical protein -
  OCL39_RS05830 (OCL39_05830) - 1137555..1138049 (-) 495 WP_263055813.1 DUF3310 domain-containing protein -
  OCL39_RS05835 (OCL39_05835) - 1138124..1138369 (-) 246 WP_260236896.1 hypothetical protein -
  OCL39_RS05840 (OCL39_05840) - 1138386..1139747 (-) 1362 WP_260236895.1 DnaB-like helicase C-terminal domain-containing protein -
  OCL39_RS05845 (OCL39_05845) - 1139744..1140742 (-) 999 WP_050161100.1 hypothetical protein -
  OCL39_RS05850 (OCL39_05850) - 1140726..1140863 (-) 138 WP_010359998.1 hypothetical protein -
  OCL39_RS05855 (OCL39_05855) - 1140860..1141087 (-) 228 WP_050158909.1 helix-turn-helix domain-containing protein -
  OCL39_RS05860 (OCL39_05860) - 1141468..1142184 (+) 717 WP_003695999.1 helix-turn-helix transcriptional regulator -
  OCL39_RS05865 (OCL39_05865) - 1142344..1142883 (+) 540 WP_003695998.1 Panacea domain-containing protein -
  OCL39_RS05870 (OCL39_05870) - 1142884..1143243 (+) 360 WP_003691733.1 hypothetical protein -
  OCL39_RS05875 (OCL39_05875) - 1143260..1143478 (-) 219 WP_003691731.1 hypothetical protein -
  OCL39_RS05880 (OCL39_05880) - 1143962..1144156 (+) 195 WP_003703103.1 hypothetical protein -
  OCL39_RS05885 (OCL39_05885) - 1144295..1144627 (+) 333 WP_260245413.1 hypothetical protein -
  OCL39_RS05890 (OCL39_05890) - 1144780..1145055 (+) 276 WP_003695501.1 NGO1622 family putative holin -
  OCL39_RS05895 (OCL39_05895) - 1145052..1145213 (+) 162 WP_047924242.1 hypothetical protein -
  OCL39_RS05900 (OCL39_05900) - 1145282..1145968 (+) 687 WP_263055815.1 phage replication initiation protein, NGO0469 family -
  OCL39_RS05905 (OCL39_05905) - 1146108..1146290 (+) 183 WP_260236894.1 hypothetical protein -
  OCL39_RS05910 (OCL39_05910) - 1146287..1146778 (+) 492 WP_050159882.1 siphovirus Gp157 family protein -
  OCL39_RS05915 (OCL39_05915) - 1146830..1147045 (+) 216 WP_003693860.1 hypothetical protein -
  OCL39_RS11920 - 1147156..1147422 (+) 267 Protein_1138 hypothetical protein -
  OCL39_RS05925 (OCL39_05925) - 1147703..1148386 (+) 684 WP_003687929.1 DUF2786 domain-containing protein -
  OCL39_RS05930 (OCL39_05930) - 1148581..1148850 (+) 270 WP_003687928.1 hypothetical protein -
  OCL39_RS05935 (OCL39_05935) - 1149205..1150397 (-) 1193 Protein_1141 tyrosine-type recombinase/integrase -
  OCL39_RS05950 (OCL39_05950) yaaA 1150928..1151707 (-) 780 WP_260236892.1 peroxide stress protein YaaA -
  OCL39_RS05955 (OCL39_05955) dapC 1152018..1153205 (-) 1188 WP_260236891.1 succinyldiaminopimelate transaminase -
  OCL39_RS05960 (OCL39_05960) dut 1153283..1153735 (-) 453 WP_260236890.1 dUTP diphosphatase -
  OCL39_RS05965 (OCL39_05965) - 1153901..1154346 (+) 446 Protein_1145 AzlC family ABC transporter permease -
  OCL39_RS05970 (OCL39_05970) pilL 1154958..1155431 (-) 474 WP_260237126.1 PilX family type IV pilin Machinery gene
  OCL39_RS05975 (OCL39_05975) pilK 1155433..1156041 (-) 609 WP_215318018.1 PilX N-terminal domain-containing pilus assembly protein Machinery gene
  OCL39_RS05980 (OCL39_05980) pilJ 1156020..1156988 (-) 969 WP_263055816.1 PilW family protein Machinery gene
  OCL39_RS05985 (OCL39_05985) pilI 1156985..1157593 (-) 609 WP_033910489.1 type IV pilus modification protein PilV Machinery gene
  OCL39_RS05990 (OCL39_05990) pilH 1157622..1158287 (-) 666 WP_263055817.1 Tfp pilus assembly protein FimT/FimU Machinery gene
  OCL39_RS05995 (OCL39_05995) dnaB 1158595..1160001 (-) 1407 WP_241532347.1 replicative DNA helicase -
  OCL39_RS06000 (OCL39_06000) - 1160164..1160745 (+) 582 WP_003701053.1 superoxide dismutase -
  OCL39_RS06005 (OCL39_06005) - 1160975..1161484 (-) 510 WP_003687909.1 isoprenylcysteine carboxyl methyltransferase family protein -
  OCL39_RS06010 (OCL39_06010) - 1161843..1162175 (-) 333 WP_003687908.1 hypothetical protein -
  OCL39_RS06015 (OCL39_06015) cysT 1162356..1163192 (+) 837 WP_260236887.1 sulfate ABC transporter permease subunit CysT -
  OCL39_RS06020 (OCL39_06020) cysW 1163381..1164202 (+) 822 WP_260236886.1 sulfate ABC transporter permease subunit CysW -
  OCL39_RS06025 (OCL39_06025) - 1164186..1164320 (+) 135 Protein_1157 IS5/IS1182 family transposase -
  OCL39_RS06030 (OCL39_06030) - 1164343..1165419 (+) 1077 WP_003701047.1 sulfate/molybdate ABC transporter ATP-binding protein -

Sequence

Protein


Download         Length: 157 a.a.        Molecular weight: 17451.27 Da        Isoelectric Point: 9.7122

>NTDB_id=735420 OCL39_RS05970 WP_260237126.1 1154958..1155431(-) (pilL) [Neisseria gonorrhoeae strain 10743]
MEQKGFTLIEMMIVVAILGIISVIAIPSYQSYIEKGYQSQLYTEMVGINNVLKQFILKNPQDDNDTLKSKLEIFVSGYKM
NPKIAKKYSVSVRFVNEGKPRAYRLVGVPNAGMGYTLSVWMNSVGDGYKCRDAASAKAYKEQLSGDGGCEALSNRKK

Nucleotide


Download         Length: 474 bp        

>NTDB_id=735420 OCL39_RS05970 WP_260237126.1 1154958..1155431(-) (pilL) [Neisseria gonorrhoeae strain 10743]
ATGGAACAAAAAGGGTTTACATTGATTGAGATGATGATAGTTGTCGCGATACTCGGCATCATCAGCGTCATTGCCATACC
TTCTTATCAGAGTTATATTGAAAAAGGCTATCAGTCCCAGCTTTATACGGAGATGGTCGGTATCAACAATGTTCTCAAAC
AGTTTATTTTGAAAAATCCCCAGGACGATAATGATACCCTCAAGAGCAAACTGGAAATATTTGTCTCAGGCTATAAGATG
AATCCGAAAATTGCCAAAAAATATAGTGTTTCGGTGCGGTTTGTCAATGAGGGAAAACCAAGGGCATACAGGTTGGTCGG
TGTTCCGAACGCGGGGATGGGTTATACTTTGTCGGTATGGATGAACAGCGTGGGCGACGGATACAAATGCCGTGATGCCG
CTTCGGCAAAGGCCTATAAAGAGCAGTTGTCCGGAGACGGTGGTTGTGAAGCCTTATCCAACCGTAAGAAATAG

Domains

Predicted by InterproScan.

Prokaryotic N-terminal methylation motif (N_methyl)

(3-25)

Minor type IV pilin, PilX (Pilin_PilX)

(31-157)


Secondary structure

Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure

Source ID Structure

Transmembrane helices

Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.


Visualization of predicted probability:


Similar proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  pilL Neisseria gonorrhoeae MS11

91.083

100

0.911
  pilX Neisseria meningitidis 8013

85.987

100

0.86