Detailed information    

insolico Bioinformatically predicted

Overview

Name   degQ   Type   Regulator
Locus tag   OEJ84_RS17715 Genome accession   NZ_CP106791
Coordinates   3320845..3320985 (-) Length   46 a.a.
NCBI ID   WP_003220708.1    Uniprot ID   G4P060
Organism   Bacillus subtilis strain 23-1     
Function   modification of regulators (predicted from homology)   
Competence regulation

Genomic Context

Location: 3315845..3325985
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  OEJ84_RS17690 (OEJ84_17690) yuxO 3316159..3316539 (-) 381 WP_003228810.1 hotdog fold thioesterase -
  OEJ84_RS17695 (OEJ84_17695) comA 3316558..3317202 (-) 645 WP_003220716.1 two-component system response regulator ComA Regulator
  OEJ84_RS17700 (OEJ84_17700) comP 3317283..3319591 (-) 2309 Protein_3427 two-component system sensor histidine kinase ComP -
  OEJ84_RS17705 (OEJ84_17705) comX 3319606..3319773 (-) 168 WP_003242801.1 competence pheromone ComX Regulator
  OEJ84_RS17710 (OEJ84_17710) comQ 3319761..3320660 (-) 900 WP_003243039.1 ComX modifying isoprenyl transferase ComQ Regulator
  OEJ84_RS17715 (OEJ84_17715) degQ 3320845..3320985 (-) 141 WP_003220708.1 degradation enzyme regulation protein DegQ Regulator
  OEJ84_RS17720 (OEJ84_17720) - 3321207..3321332 (+) 126 WP_003228793.1 hypothetical protein -
  OEJ84_RS17725 (OEJ84_17725) - 3321446..3321814 (+) 369 WP_003243784.1 hypothetical protein -
  OEJ84_RS17730 (OEJ84_17730) pdeH 3321790..3323019 (-) 1230 WP_003243525.1 cyclic di-GMP phosphodiesterase -
  OEJ84_RS17735 (OEJ84_17735) pncB 3323156..3324628 (-) 1473 WP_003228788.1 nicotinate phosphoribosyltransferase -
  OEJ84_RS17740 (OEJ84_17740) pncA 3324644..3325195 (-) 552 WP_003243099.1 cysteine hydrolase family protein -
  OEJ84_RS17745 (OEJ84_17745) yueI 3325292..3325690 (-) 399 WP_003242987.1 YueI family protein -

Sequence

Protein


Download         Length: 46 a.a.        Molecular weight: 5546.44 Da        Isoelectric Point: 6.2559

>NTDB_id=735271 OEJ84_RS17715 WP_003220708.1 3320845..3320985(-) (degQ) [Bacillus subtilis strain 23-1]
MEKKLEEVKQLLFRLELDIKETTDSLRNINKSIDQLDKYNYAMKIS

Nucleotide


Download         Length: 141 bp        

>NTDB_id=735271 OEJ84_RS17715 WP_003220708.1 3320845..3320985(-) (degQ) [Bacillus subtilis strain 23-1]
ATGGAAAAGAAACTTGAAGAAGTAAAACAATTGTTATTCCGACTCGAACTTGATATTAAAGAAACGACAGATTCATTACG
AAACATTAACAAAAGCATTGATCAACTCGATAAATACAATTATGCAATGAAAATTTCGTGA

Domains

Predicted by InterproScan.

DegQ (SacQ) family (DegQ)

(1-46)


Secondary structure

Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure

Source ID Structure
  AlphaFold DB G4P060

Transmembrane helices

Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.


Visualization of predicted probability:


Similar proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  degQ Bacillus subtilis subsp. subtilis str. 168

100

100

1