Detailed information    

insolico Bioinformatically predicted

Overview


Name   comX   Type   Regulator
Locus tag   OEJ84_RS17705 Genome accession   NZ_CP106791
Coordinates   3319606..3319773 (-) Length   55 a.a.
NCBI ID   WP_003242801.1    Uniprot ID   G9LQ80
Organism   Bacillus subtilis strain 23-1     
Function   binding to ComP; trigger autophosphorylation of ComP (predicted from homology)   
Competence regulation

Genomic Context


Location: 3314606..3324773
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  OEJ84_RS17675 (OEJ84_17675) mrpE 3315002..3315478 (+) 477 WP_003244015.1 Na+/H+ antiporter subunit E -
  OEJ84_RS17680 (OEJ84_17680) mrpF 3315478..3315762 (+) 285 WP_003228814.1 Na(+)/H(+) antiporter subunit F1 -
  OEJ84_RS17685 (OEJ84_17685) mnhG 3315746..3316120 (+) 375 WP_003244302.1 monovalent cation/H(+) antiporter subunit G -
  OEJ84_RS17690 (OEJ84_17690) yuxO 3316159..3316539 (-) 381 WP_003228810.1 hotdog fold thioesterase -
  OEJ84_RS17695 (OEJ84_17695) comA 3316558..3317202 (-) 645 WP_003220716.1 two-component system response regulator ComA Regulator
  OEJ84_RS17700 (OEJ84_17700) comP 3317283..3319591 (-) 2309 Protein_3427 two-component system sensor histidine kinase ComP -
  OEJ84_RS17705 (OEJ84_17705) comX 3319606..3319773 (-) 168 WP_003242801.1 competence pheromone ComX Regulator
  OEJ84_RS17710 (OEJ84_17710) comQ 3319761..3320660 (-) 900 WP_003243039.1 ComX modifying isoprenyl transferase ComQ Regulator
  OEJ84_RS17715 (OEJ84_17715) degQ 3320845..3320985 (-) 141 WP_003220708.1 degradation enzyme regulation protein DegQ Regulator
  OEJ84_RS17720 (OEJ84_17720) - 3321207..3321332 (+) 126 WP_003228793.1 hypothetical protein -
  OEJ84_RS17725 (OEJ84_17725) - 3321446..3321814 (+) 369 WP_003243784.1 hypothetical protein -
  OEJ84_RS17730 (OEJ84_17730) pdeH 3321790..3323019 (-) 1230 WP_003243525.1 cyclic di-GMP phosphodiesterase -
  OEJ84_RS17735 (OEJ84_17735) pncB 3323156..3324628 (-) 1473 WP_003228788.1 nicotinate phosphoribosyltransferase -

Sequence


Protein


Download         Length: 55 a.a.        Molecular weight: 6518.42 Da        Isoelectric Point: 4.3285

>NTDB_id=735269 OEJ84_RS17705 WP_003242801.1 3319606..3319773(-) (comX) [Bacillus subtilis strain 23-1]
MQDLINYFLNYPEALKKLKNKEACLIGFDVQETETIIKAYNDYYLADPITRQWGD

Nucleotide


Download         Length: 168 bp        

>NTDB_id=735269 OEJ84_RS17705 WP_003242801.1 3319606..3319773(-) (comX) [Bacillus subtilis strain 23-1]
ATGCAAGACCTAATTAACTACTTTTTAAATTATCCTGAGGCTTTAAAAAAATTGAAAAATAAAGAAGCCTGCCTTATAGG
TTTTGATGTGCAAGAAACTGAAACAATAATTAAAGCTTATAATGATTATTATCTGGCTGATCCAATAACCCGTCAATGGG
GTGATTAA

Domains



No domain identified.



Secondary structure


Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure


Source ID Structure
  AlphaFold DB G9LQ80

Transmembrane helices


Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.



Visualization of predicted probability:


Similar proteins


Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  comX Bacillus subtilis subsp. subtilis str. 168

100

100

1