Detailed information
Bioinformatically predicted
Overview
| Name | comC/blpC | Type | Regulator |
| Locus tag | FNL60_RS01565 | Genome accession | NZ_AP019720 |
| Coordinates | 298390..298536 (-) | Length | 48 a.a. |
| NCBI ID | WP_002280232.1 | Uniprot ID | Q1WBZ0 |
| Organism | Streptococcus mutans strain NBRC 13955 | ||
| Function | binding to ComD; induce autophosphorylation of ComD; regulation of comX expression (predicted from homology) Competence regulation |
||
Genomic Context
Location: 293390..303536
| Locus tag | Gene name | Coordinates (strand) | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| FNL60_RS01545 (SM3g_02710) | - | 294387..295013 (+) | 627 | WP_002265453.1 | hypothetical protein | - |
| FNL60_RS01550 (SM3g_02720) | - | 295060..295698 (+) | 639 | WP_002265117.1 | VTT domain-containing protein | - |
| FNL60_RS01555 (SM3g_02730) | comE/blpR | 296179..296931 (+) | 753 | WP_002280234.1 | response regulator transcription factor | Regulator |
| FNL60_RS01560 (SM3g_02740) | comD/blpH | 296928..298253 (+) | 1326 | WP_002280233.1 | sensor histidine kinase | Regulator |
| FNL60_RS01565 (SM3g_02750) | comC/blpC | 298390..298536 (-) | 147 | WP_002280232.1 | ComC/BlpC family leader-containing pheromone/bacteriocin | Regulator |
| FNL60_RS01570 (SM3g_02760) | - | 298803..299024 (+) | 222 | WP_002312090.1 | Blp family class II bacteriocin | - |
| FNL60_RS01575 (SM3g_02770) | - | 299055..299273 (+) | 219 | WP_025985888.1 | Blp family class II bacteriocin | - |
| FNL60_RS01580 (SM3g_02780) | - | 299359..299763 (+) | 405 | WP_002280427.1 | hypothetical protein | - |
| FNL60_RS10455 | - | 299886..300098 (-) | 213 | Protein_277 | IS3 family transposase | - |
| FNL60_RS01595 (SM3g_02800) | - | 300538..300702 (+) | 165 | WP_002265308.1 | hypothetical protein | - |
| FNL60_RS01605 (SM3g_02810) | - | 301086..301277 (+) | 192 | WP_002312088.1 | Blp family class II bacteriocin | - |
| FNL60_RS01610 (SM3g_02820) | - | 301441..301629 (+) | 189 | WP_002280338.1 | Blp family class II bacteriocin | - |
| FNL60_RS01615 (SM3g_02830) | - | 302114..303142 (+) | 1029 | WP_002280337.1 | thioredoxin family protein | - |
Sequence
Protein
Download Length: 48 a.a. Molecular weight: 5464.37 Da Isoelectric Point: 10.7837
>NTDB_id=73510 FNL60_RS01565 WP_002280232.1 298390..298536(-) (comC/blpC) [Streptococcus mutans strain NBRC 13955]
MKKTPSLKNDFKEIKTDELEIIIGGSGSLSTFFRLFNRSFTQALGKIR
MKKTPSLKNDFKEIKTDELEIIIGGSGSLSTFFRLFNRSFTQALGKIR
Nucleotide
Download Length: 147 bp
>NTDB_id=73510 FNL60_RS01565 WP_002280232.1 298390..298536(-) (comC/blpC) [Streptococcus mutans strain NBRC 13955]
ATGAAAAAAACACCATCATTAAAAAATGACTTTAAAGAAATTAAAACTGATGAATTAGAGATTATCATTGGCGGAAGCGG
AAGCCTATCAACATTTTTCCGGCTGTTTAACAGAAGTTTTACACAAGCTTTGGGGAAAATAAGATAG
ATGAAAAAAACACCATCATTAAAAAATGACTTTAAAGAAATTAAAACTGATGAATTAGAGATTATCATTGGCGGAAGCGG
AAGCCTATCAACATTTTTCCGGCTGTTTAACAGAAGTTTTACACAAGCTTTGGGGAAAATAAGATAG
Similar proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|---|---|---|---|
| comC/blpC | Streptococcus mutans UA159 |
97.826 |
95.833 |
0.937 |