Detailed information
Overview
| Name | pilV | Type | Machinery gene |
| Locus tag | LLE33_RS02340 | Genome accession | NZ_CP106767 |
| Coordinates | 452185..452796 (+) | Length | 203 a.a. |
| NCBI ID | WP_003699626.1 | Uniprot ID | - |
| Organism | Neisseria gonorrhoeae strain 10610 | ||
| Function | repress natural transformation (predicted from homology) Competence regulation |
||
Related MGE
Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.
Gene-MGE association summary
| MGE type | MGE coordinates | Gene coordinates | Relative position | Distance (bp) |
|---|---|---|---|---|
| Prophage | 440005..493489 | 452185..452796 | within | 0 |
Gene organization within MGE regions
Location: 440005..493489
| Locus tag | Gene name | Coordinates (strand) | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| LLE33_RS02280 (LLE33_02280) | - | 440005..440988 (+) | 984 | WP_003687900.1 | ribose-phosphate pyrophosphokinase | - |
| LLE33_RS02285 (LLE33_02285) | - | 441055..441627 (+) | 573 | WP_003687901.1 | 50S ribosomal protein L25/general stress protein Ctc | - |
| LLE33_RS02290 (LLE33_02290) | - | 441753..442922 (-) | 1170 | WP_003687902.1 | D-alanyl-D-alanine carboxypeptidase family protein | - |
| LLE33_RS02295 (LLE33_02295) | ilvA | 443071..444597 (+) | 1527 | WP_003687904.1 | threonine ammonia-lyase, biosynthetic | - |
| LLE33_RS02300 (LLE33_02300) | - | 444653..445729 (-) | 1077 | WP_003692814.1 | sulfate/molybdate ABC transporter ATP-binding protein | - |
| LLE33_RS02305 (LLE33_02305) | cysW | 445726..446586 (-) | 861 | WP_003699617.1 | sulfate ABC transporter permease subunit CysW | - |
| LLE33_RS02310 (LLE33_02310) | cysT | 446775..447602 (-) | 828 | WP_003699619.1 | sulfate ABC transporter permease subunit CysT | - |
| LLE33_RS02315 (LLE33_02315) | - | 447783..448115 (+) | 333 | WP_003687908.1 | hypothetical protein | - |
| LLE33_RS02320 (LLE33_02320) | - | 448442..448951 (+) | 510 | WP_003687909.1 | isoprenylcysteine carboxyl methyltransferase family protein | - |
| LLE33_RS02325 (LLE33_02325) | - | 449183..449764 (-) | 582 | WP_003690895.1 | superoxide dismutase | - |
| LLE33_RS02330 (LLE33_02330) | dnaB | 449928..451334 (+) | 1407 | WP_003699622.1 | replicative DNA helicase | - |
| LLE33_RS02335 (LLE33_02335) | pilH | 451488..452153 (+) | 666 | WP_003699624.1 | Tfp pilus assembly protein FimT/FimU | Machinery gene |
| LLE33_RS02340 (LLE33_02340) | pilV | 452185..452796 (+) | 612 | WP_003699626.1 | type IV pilus modification protein PilV | Machinery gene |
| LLE33_RS02345 (LLE33_02345) | pilJ | 452793..453743 (+) | 951 | WP_229433524.1 | PilW family protein | Machinery gene |
| LLE33_RS02350 (LLE33_02350) | pilK | 453722..454333 (+) | 612 | WP_229433526.1 | PilX N-terminal domain-containing pilus assembly protein | Machinery gene |
| LLE33_RS02355 (LLE33_02355) | pilL | 454335..454808 (+) | 474 | WP_172760650.1 | PilX family type IV pilin | Machinery gene |
| LLE33_RS02360 (LLE33_02360) | - | 454878..455186 (-) | 309 | WP_025456177.1 | AzlD family protein | - |
| LLE33_RS02365 (LLE33_02365) | - | 455183..455893 (-) | 711 | Protein_466 | AzlC family ABC transporter permease | - |
| LLE33_RS02370 (LLE33_02370) | dut | 456059..456511 (+) | 453 | WP_003699637.1 | dUTP diphosphatase | - |
| LLE33_RS02375 (LLE33_02375) | dapC | 456587..457774 (+) | 1188 | WP_003699639.1 | succinyldiaminopimelate transaminase | - |
| LLE33_RS02380 (LLE33_02380) | yaaA | 457930..458709 (+) | 780 | WP_003699641.1 | peroxide stress protein YaaA | - |
| LLE33_RS02395 (LLE33_02395) | - | 459239..460432 (+) | 1194 | WP_017146746.1 | phage integrase central domain-containing protein | - |
| LLE33_RS02400 (LLE33_02400) | - | 460788..461057 (-) | 270 | WP_003687928.1 | hypothetical protein | - |
| LLE33_RS02405 (LLE33_02405) | - | 461252..461935 (-) | 684 | WP_003687929.1 | DUF2786 domain-containing protein | - |
| LLE33_RS11890 | - | 462216..462482 (-) | 267 | Protein_473 | hypothetical protein | - |
| LLE33_RS02415 (LLE33_02415) | - | 462593..462808 (-) | 216 | WP_003691538.1 | hypothetical protein | - |
| LLE33_RS02420 (LLE33_02420) | - | 462860..463351 (-) | 492 | WP_033911206.1 | siphovirus Gp157 family protein | - |
| LLE33_RS02425 (LLE33_02425) | - | 463348..463530 (-) | 183 | WP_003691535.1 | hypothetical protein | - |
| LLE33_RS02430 (LLE33_02430) | - | 463670..464356 (-) | 687 | WP_010357532.1 | phage replication initiation protein, NGO0469 family | - |
| LLE33_RS02435 (LLE33_02435) | - | 464425..464586 (-) | 162 | WP_003691530.1 | hypothetical protein | - |
| LLE33_RS02440 (LLE33_02440) | - | 464583..464858 (-) | 276 | WP_151266294.1 | NGO1622 family putative holin | - |
| LLE33_RS02445 (LLE33_02445) | - | 465011..465343 (-) | 333 | WP_047923919.1 | hypothetical protein | - |
| LLE33_RS02450 (LLE33_02450) | - | 465485..465628 (-) | 144 | WP_229931536.1 | hypothetical protein | - |
| LLE33_RS02455 (LLE33_02455) | - | 465625..466101 (-) | 477 | WP_002255718.1 | DUF6948 domain-containing protein | - |
| LLE33_RS02460 (LLE33_02460) | - | 466134..466334 (-) | 201 | WP_003692842.1 | hypothetical protein | - |
| LLE33_RS02465 (LLE33_02465) | - | 466532..466945 (-) | 414 | WP_003687963.1 | hypothetical protein | - |
| LLE33_RS02470 (LLE33_02470) | - | 466942..467403 (-) | 462 | WP_003687965.1 | helix-turn-helix domain-containing protein | - |
| LLE33_RS02475 (LLE33_02475) | - | 467420..467857 (-) | 438 | WP_003687967.1 | hypothetical protein | - |
| LLE33_RS02480 (LLE33_02480) | - | 467970..468686 (-) | 717 | WP_003687969.1 | LexA family transcriptional regulator | - |
| LLE33_RS02485 (LLE33_02485) | - | 468761..468991 (+) | 231 | WP_020997318.1 | Cro/CI family transcriptional regulator | - |
| LLE33_RS02490 (LLE33_02490) | - | 469071..469226 (+) | 156 | WP_003698902.1 | hypothetical protein | - |
| LLE33_RS02495 (LLE33_02495) | - | 469203..469391 (-) | 189 | WP_003691445.1 | hypothetical protein | - |
| LLE33_RS02500 (LLE33_02500) | - | 469564..469791 (+) | 228 | WP_003698261.1 | helix-turn-helix domain-containing protein | - |
| LLE33_RS02505 (LLE33_02505) | - | 470470..470973 (+) | 504 | WP_010360005.1 | hypothetical protein | - |
| LLE33_RS02510 (LLE33_02510) | - | 470970..472331 (+) | 1362 | WP_003689132.1 | DnaB-like helicase C-terminal domain-containing protein | - |
| LLE33_RS02515 (LLE33_02515) | - | 472348..472599 (+) | 252 | WP_003703849.1 | hypothetical protein | - |
| LLE33_RS02520 (LLE33_02520) | - | 472613..473107 (+) | 495 | WP_047923539.1 | DUF3310 domain-containing protein | - |
| LLE33_RS02525 (LLE33_02525) | - | 473490..473639 (+) | 150 | WP_047920329.1 | phage associated protein | - |
| LLE33_RS02530 (LLE33_02530) | - | 473668..473949 (+) | 282 | WP_003689109.1 | hypothetical protein | - |
| LLE33_RS02535 (LLE33_02535) | - | 473940..474377 (+) | 438 | WP_229433529.1 | RusA family crossover junction endodeoxyribonuclease | - |
| LLE33_RS02540 (LLE33_02540) | - | 474370..474675 (+) | 306 | WP_025456182.1 | DUF1364 domain-containing protein | - |
| LLE33_RS02545 (LLE33_02545) | - | 474672..475055 (+) | 384 | WP_003699764.1 | recombination protein NinB | - |
| LLE33_RS02550 (LLE33_02550) | - | 475046..475564 (+) | 519 | WP_003693459.1 | HNH endonuclease | - |
| LLE33_RS02555 (LLE33_02555) | - | 475629..476051 (+) | 423 | WP_003690919.1 | hypothetical protein | - |
| LLE33_RS02560 (LLE33_02560) | - | 476051..476590 (+) | 540 | WP_003693457.1 | hypothetical protein | - |
| LLE33_RS02565 (LLE33_02565) | - | 476571..477845 (+) | 1275 | WP_003698265.1 | PBSX family phage terminase large subunit | - |
| LLE33_RS02570 (LLE33_02570) | - | 477830..480097 (+) | 2268 | WP_229433533.1 | hypothetical protein | - |
| LLE33_RS02575 (LLE33_02575) | - | 480335..481531 (+) | 1197 | WP_003693452.1 | hypothetical protein | - |
| LLE33_RS02580 (LLE33_02580) | - | 481528..488835 (+) | 7308 | WP_003698268.1 | PLxRFG domain-containing protein | - |
| LLE33_RS02585 (LLE33_02585) | - | 489461..490756 (+) | 1296 | WP_003693441.1 | DUF4043 family protein | - |
| LLE33_RS02590 (LLE33_02590) | - | 490814..491287 (+) | 474 | WP_003693439.1 | hypothetical protein | - |
| LLE33_RS02595 (LLE33_02595) | - | 491293..491778 (+) | 486 | WP_003693438.1 | hypothetical protein | - |
| LLE33_RS02600 (LLE33_02600) | - | 491775..492449 (+) | 675 | WP_003693436.1 | hypothetical protein | - |
| LLE33_RS02605 (LLE33_02605) | - | 492452..492601 (+) | 150 | WP_017146863.1 | hypothetical protein | - |
| LLE33_RS02610 (LLE33_02610) | - | 492638..493489 (-) | 852 | WP_003699775.1 | Bro-N domain-containing protein | - |
Sequence
Protein
Download Length: 203 a.a. Molecular weight: 21997.01 Da Isoelectric Point: 5.0177
>NTDB_id=734675 LLE33_RS02340 WP_003699626.1 452185..452796(+) (pilV) [Neisseria gonorrhoeae strain 10610]
MKNNDCLRLKNPQSGMALIEVLVAMLVLTIGILALLSVQLRTVASVREAETQTIVSQITQNLMEGMLMNPTIDLDSNKKN
YSLYMGKQTPSAVDGKFTLDAEKSKAQLAEEQLKRFSYELKNALPDAVGIHYAVCKDSSGNEPTLSDSGVFSSNCDNKAN
GDTLIKVLWVNDSAGDSDISRTNLGVSGGNIVYTYQARVGGRE
MKNNDCLRLKNPQSGMALIEVLVAMLVLTIGILALLSVQLRTVASVREAETQTIVSQITQNLMEGMLMNPTIDLDSNKKN
YSLYMGKQTPSAVDGKFTLDAEKSKAQLAEEQLKRFSYELKNALPDAVGIHYAVCKDSSGNEPTLSDSGVFSSNCDNKAN
GDTLIKVLWVNDSAGDSDISRTNLGVSGGNIVYTYQARVGGRE
Nucleotide
Download Length: 612 bp
>NTDB_id=734675 LLE33_RS02340 WP_003699626.1 452185..452796(+) (pilV) [Neisseria gonorrhoeae strain 10610]
ATGAAGAATAATGATTGCTTGCGCCTGAAAAATCCCCAGTCCGGTATGGCGCTGATAGAAGTCTTGGTTGCTATGCTCGT
TCTGACCATCGGTATTTTGGCATTGCTGTCCGTGCAGCTGCGGACGGTCGCTTCCGTCAGGGAAGCGGAGACGCAAACCA
TCGTCAGCCAAATCACGCAAAACCTGATGGAAGGAATGTTGATGAATCCGACCATTGATTTGGATAGCAACAAGAAAAAC
TATAGTCTTTACATGGGAAAACAGACACCATCAGCTGTGGATGGTAAGTTTACGCTTGATGCCGAGAAAAGTAAGGCGCA
GTTGGCAGAGGAACAATTGAAGAGATTTAGTTATGAGCTGAAAAATGCCTTGCCGGATGCGGTCGGTATTCATTACGCCG
TCTGCAAGGATTCGTCGGGTAACGAGCCGACATTGTCCGACAGCGGTGTTTTTTCTTCAAATTGCGACAATAAGGCAAAC
GGGGATACTTTGATTAAAGTATTGTGGGTAAATGATTCGGCAGGGGATTCGGATATTTCCCGTACGAATCTTGGGGTGAG
CGGCGGCAATATCGTATATACTTATCAGGCAAGGGTCGGAGGTCGTGAATGA
ATGAAGAATAATGATTGCTTGCGCCTGAAAAATCCCCAGTCCGGTATGGCGCTGATAGAAGTCTTGGTTGCTATGCTCGT
TCTGACCATCGGTATTTTGGCATTGCTGTCCGTGCAGCTGCGGACGGTCGCTTCCGTCAGGGAAGCGGAGACGCAAACCA
TCGTCAGCCAAATCACGCAAAACCTGATGGAAGGAATGTTGATGAATCCGACCATTGATTTGGATAGCAACAAGAAAAAC
TATAGTCTTTACATGGGAAAACAGACACCATCAGCTGTGGATGGTAAGTTTACGCTTGATGCCGAGAAAAGTAAGGCGCA
GTTGGCAGAGGAACAATTGAAGAGATTTAGTTATGAGCTGAAAAATGCCTTGCCGGATGCGGTCGGTATTCATTACGCCG
TCTGCAAGGATTCGTCGGGTAACGAGCCGACATTGTCCGACAGCGGTGTTTTTTCTTCAAATTGCGACAATAAGGCAAAC
GGGGATACTTTGATTAAAGTATTGTGGGTAAATGATTCGGCAGGGGATTCGGATATTTCCCGTACGAATCTTGGGGTGAG
CGGCGGCAATATCGTATATACTTATCAGGCAAGGGTCGGAGGTCGTGAATGA
3D structure
| Source | ID | Structure |
|---|
Similar proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|---|---|---|---|
| pilV | Neisseria meningitidis 8013 |
87.44 |
100 |
0.892 |
| pilI | Neisseria gonorrhoeae MS11 |
82.759 |
100 |
0.828 |
| pilV | Neisseria gonorrhoeae MS11 |
82.759 |
100 |
0.828 |