Detailed information    

insolico Bioinformatically predicted

Overview

Name   pilL   Type   Machinery gene
Locus tag   LLE30_RS02345 Genome accession   NZ_CP106765
Coordinates   454421..454894 (+) Length   157 a.a.
NCBI ID   WP_172760650.1    Uniprot ID   -
Organism   Neisseria gonorrhoeae strain 10500     
Function   type IV pilus (predicted from homology)   
DNA binding and uptake

Related MGE

Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.

Gene-MGE association summary

MGE type MGE coordinates Gene coordinates Relative position Distance (bp)
Prophage 440091..493576 454421..454894 within 0


Gene organization within MGE regions


Location: 440091..493576
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  LLE30_RS02270 (LLE30_02270) - 440091..441074 (+) 984 WP_003687900.1 ribose-phosphate pyrophosphokinase -
  LLE30_RS02275 (LLE30_02275) - 441141..441713 (+) 573 WP_003687901.1 50S ribosomal protein L25/general stress protein Ctc -
  LLE30_RS02280 (LLE30_02280) - 441839..443008 (-) 1170 WP_003687902.1 D-alanyl-D-alanine carboxypeptidase family protein -
  LLE30_RS02285 (LLE30_02285) ilvA 443157..444683 (+) 1527 WP_003687904.1 threonine ammonia-lyase, biosynthetic -
  LLE30_RS02290 (LLE30_02290) - 444739..445815 (-) 1077 WP_003692814.1 sulfate/molybdate ABC transporter ATP-binding protein -
  LLE30_RS02295 (LLE30_02295) cysW 445812..446672 (-) 861 WP_003699617.1 sulfate ABC transporter permease subunit CysW -
  LLE30_RS02300 (LLE30_02300) cysT 446861..447688 (-) 828 WP_003699619.1 sulfate ABC transporter permease subunit CysT -
  LLE30_RS02305 (LLE30_02305) - 447869..448201 (+) 333 WP_003687908.1 hypothetical protein -
  LLE30_RS02310 (LLE30_02310) - 448528..449037 (+) 510 WP_003687909.1 isoprenylcysteine carboxyl methyltransferase family protein -
  LLE30_RS02315 (LLE30_02315) - 449269..449850 (-) 582 WP_003690895.1 superoxide dismutase -
  LLE30_RS02320 (LLE30_02320) dnaB 450014..451420 (+) 1407 WP_003699622.1 replicative DNA helicase -
  LLE30_RS02325 (LLE30_02325) pilH 451574..452239 (+) 666 WP_003699624.1 Tfp pilus assembly protein FimT/FimU Machinery gene
  LLE30_RS02330 (LLE30_02330) pilV 452271..452882 (+) 612 WP_003699626.1 type IV pilus modification protein PilV Machinery gene
  LLE30_RS02335 (LLE30_02335) pilJ 452879..453829 (+) 951 WP_229433524.1 PilW family protein Machinery gene
  LLE30_RS02340 (LLE30_02340) pilK 453808..454419 (+) 612 WP_229433526.1 PilX N-terminal domain-containing pilus assembly protein Machinery gene
  LLE30_RS02345 (LLE30_02345) pilL 454421..454894 (+) 474 WP_172760650.1 PilX family type IV pilin Machinery gene
  LLE30_RS02350 (LLE30_02350) - 454964..455272 (-) 309 WP_025456177.1 AzlD family protein -
  LLE30_RS02355 (LLE30_02355) - 455269..455979 (-) 711 Protein_462 AzlC family ABC transporter permease -
  LLE30_RS02360 (LLE30_02360) dut 456145..456597 (+) 453 WP_003699637.1 dUTP diphosphatase -
  LLE30_RS02365 (LLE30_02365) dapC 456673..457860 (+) 1188 WP_003699639.1 succinyldiaminopimelate transaminase -
  LLE30_RS02370 (LLE30_02370) yaaA 458016..458795 (+) 780 WP_003699641.1 peroxide stress protein YaaA -
  LLE30_RS02385 (LLE30_02385) - 459325..460518 (+) 1194 WP_017146746.1 phage integrase central domain-containing protein -
  LLE30_RS02390 (LLE30_02390) - 460874..461143 (-) 270 WP_003687928.1 hypothetical protein -
  LLE30_RS02395 (LLE30_02395) - 461338..462021 (-) 684 WP_003687929.1 DUF2786 domain-containing protein -
  LLE30_RS11750 - 462302..462568 (-) 267 Protein_469 hypothetical protein -
  LLE30_RS02405 (LLE30_02405) - 462679..462894 (-) 216 WP_003691538.1 hypothetical protein -
  LLE30_RS02410 (LLE30_02410) - 462946..463437 (-) 492 WP_033911206.1 siphovirus Gp157 family protein -
  LLE30_RS02415 (LLE30_02415) - 463434..463616 (-) 183 WP_003691535.1 hypothetical protein -
  LLE30_RS02420 (LLE30_02420) - 463756..464442 (-) 687 WP_010357532.1 phage replication initiation protein, NGO0469 family -
  LLE30_RS02425 (LLE30_02425) - 464511..464672 (-) 162 WP_003691530.1 hypothetical protein -
  LLE30_RS02430 (LLE30_02430) - 464669..464944 (-) 276 WP_033911205.1 NGO1622 family putative holin -
  LLE30_RS02435 (LLE30_02435) - 465097..465429 (-) 333 WP_003695500.1 hypothetical protein -
  LLE30_RS02440 (LLE30_02440) - 465571..465714 (-) 144 WP_229931536.1 hypothetical protein -
  LLE30_RS02445 (LLE30_02445) - 465711..466187 (-) 477 WP_002255718.1 DUF6948 domain-containing protein -
  LLE30_RS02450 (LLE30_02450) - 466220..466420 (-) 201 WP_003692842.1 hypothetical protein -
  LLE30_RS02455 (LLE30_02455) - 466618..467031 (-) 414 WP_003687963.1 hypothetical protein -
  LLE30_RS02460 (LLE30_02460) - 467028..467489 (-) 462 WP_003687965.1 helix-turn-helix domain-containing protein -
  LLE30_RS02465 (LLE30_02465) - 467506..467943 (-) 438 WP_003687967.1 hypothetical protein -
  LLE30_RS02470 (LLE30_02470) - 468056..468772 (-) 717 WP_003687969.1 LexA family transcriptional regulator -
  LLE30_RS02475 (LLE30_02475) - 468847..469077 (+) 231 WP_020997318.1 Cro/CI family transcriptional regulator -
  LLE30_RS02480 (LLE30_02480) - 469157..469312 (+) 156 WP_003698902.1 hypothetical protein -
  LLE30_RS02485 (LLE30_02485) - 469289..469477 (-) 189 WP_003691445.1 hypothetical protein -
  LLE30_RS02490 (LLE30_02490) - 469650..469877 (+) 228 WP_003698261.1 helix-turn-helix domain-containing protein -
  LLE30_RS02495 (LLE30_02495) - 469995..470462 (+) 468 WP_229692802.1 hypothetical protein -
  LLE30_RS02500 (LLE30_02500) - 470557..471060 (+) 504 WP_010360005.1 hypothetical protein -
  LLE30_RS02505 (LLE30_02505) - 471057..472418 (+) 1362 WP_003689132.1 DnaB-like helicase C-terminal domain-containing protein -
  LLE30_RS02510 (LLE30_02510) - 472435..472686 (+) 252 WP_003703849.1 hypothetical protein -
  LLE30_RS02515 (LLE30_02515) - 472700..473194 (+) 495 WP_003692852.1 DUF3310 domain-containing protein -
  LLE30_RS02520 (LLE30_02520) - 473577..473726 (+) 150 WP_047920329.1 phage associated protein -
  LLE30_RS02525 (LLE30_02525) - 473755..474036 (+) 282 WP_003689109.1 hypothetical protein -
  LLE30_RS02530 (LLE30_02530) - 474027..474464 (+) 438 WP_229433529.1 RusA family crossover junction endodeoxyribonuclease -
  LLE30_RS02535 (LLE30_02535) - 474457..474762 (+) 306 WP_025456182.1 DUF1364 domain-containing protein -
  LLE30_RS02540 (LLE30_02540) - 474759..475142 (+) 384 WP_003699764.1 recombination protein NinB -
  LLE30_RS02545 (LLE30_02545) - 475133..475651 (+) 519 WP_003693459.1 HNH endonuclease -
  LLE30_RS02550 (LLE30_02550) - 475716..476138 (+) 423 WP_003690919.1 hypothetical protein -
  LLE30_RS02555 (LLE30_02555) - 476138..476677 (+) 540 WP_003693457.1 hypothetical protein -
  LLE30_RS02560 (LLE30_02560) - 476658..477932 (+) 1275 WP_003698265.1 PBSX family phage terminase large subunit -
  LLE30_RS02565 (LLE30_02565) - 477917..480184 (+) 2268 WP_229433533.1 hypothetical protein -
  LLE30_RS02570 (LLE30_02570) - 480422..481618 (+) 1197 WP_003693452.1 hypothetical protein -
  LLE30_RS02575 (LLE30_02575) - 481615..488922 (+) 7308 WP_229433535.1 PLxRFG domain-containing protein -
  LLE30_RS02580 (LLE30_02580) - 489548..490843 (+) 1296 WP_003693441.1 DUF4043 family protein -
  LLE30_RS02585 (LLE30_02585) - 490901..491374 (+) 474 WP_003693439.1 hypothetical protein -
  LLE30_RS02590 (LLE30_02590) - 491380..491865 (+) 486 WP_003693438.1 hypothetical protein -
  LLE30_RS02595 (LLE30_02595) - 491862..492536 (+) 675 WP_003693436.1 hypothetical protein -
  LLE30_RS02600 (LLE30_02600) - 492539..492688 (+) 150 WP_017146863.1 hypothetical protein -
  LLE30_RS02605 (LLE30_02605) - 492725..493576 (-) 852 WP_003699775.1 Bro-N domain-containing protein -

Sequence

Protein


Download         Length: 157 a.a.        Molecular weight: 17429.25 Da        Isoelectric Point: 9.7225

>NTDB_id=734629 LLE30_RS02345 WP_172760650.1 454421..454894(+) (pilL) [Neisseria gonorrhoeae strain 10500]
MEQKGFTLIEMMIVVAILGIISVIAIPSYQSYIEKGYQSQLYTEMVGINNVLKQFILKNPLDDNQTIKTKLEIFVSGYKM
NPKIAKKYSVSVAFANTEKPRVYRLVGVPKAGTGYTLSVWMNSVGDGYKCRDAASAQAYSETLSANTGCEAFSNRKK

Nucleotide


Download         Length: 474 bp        

>NTDB_id=734629 LLE30_RS02345 WP_172760650.1 454421..454894(+) (pilL) [Neisseria gonorrhoeae strain 10500]
ATGGAACAAAAAGGGTTTACATTGATTGAGATGATGATAGTTGTCGCGATACTCGGCATTATCAGCGTCATTGCCATACC
TTCTTATCAAAGTTATATTGAAAAAGGCTATCAGTCCCAGCTTTATACGGAGATGGTCGGTATCAACAATGTTCTCAAAC
AGTTTATTTTGAAAAATCCCCTGGACGATAATCAGACCATCAAGACCAAACTGGAAATATTTGTCTCAGGCTATAAGATG
AATCCGAAAATTGCCAAAAAATATAGTGTTTCGGTGGCATTTGCCAATACGGAAAAACCAAGGGTATACAGGTTGGTCGG
CGTTCCGAAGGCAGGGACGGGTTATACCTTGTCGGTATGGATGAACAGCGTGGGCGACGGATACAAATGCCGTGATGCCG
CTTCTGCCCAGGCCTATTCGGAGACCTTGTCCGCAAATACCGGCTGTGAAGCTTTCTCTAATCGTAAAAAATAG

Domains

Predicted by InterproScan.

Minor type IV pilin, PilX (Pilin_PilX)

(31-157)

Prokaryotic N-terminal methylation motif (N_methyl)

(3-25)


Secondary structure

Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure

Source ID Structure

Transmembrane helices

Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.


Visualization of predicted probability:


Similar proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  pilL Neisseria gonorrhoeae MS11

91.083

100

0.911
  pilX Neisseria meningitidis 8013

88.535

100

0.885