Detailed information    

insolico Bioinformatically predicted

Overview


Name   comGF   Type   Machinery gene
Locus tag   P5655_RS10530 Genome accession   NZ_CP120681
Coordinates   1921237..1921620 (-) Length   127 a.a.
NCBI ID   WP_003230168.1    Uniprot ID   P25958
Organism   Bacillus subtilis strain DSM 10     
Function   dsDNA binding to the cell surface; assembly of the pseudopilus (predicted from homology)   
DNA binding and uptake

Genomic Context


Location: 1916237..1926620
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  P5655_RS10490 (P5655_10490) sinI 1917171..1917344 (+) 174 WP_003230187.1 anti-repressor SinI Regulator
  P5655_RS10495 (P5655_10495) sinR 1917378..1917713 (+) 336 WP_003226345.1 transcriptional regulator SinR Regulator
  P5655_RS10500 (P5655_10500) tasA 1917806..1918591 (-) 786 WP_004398632.1 biofilm matrix protein TasA -
  P5655_RS10505 (P5655_10505) sipW 1918655..1919227 (-) 573 WP_003246088.1 signal peptidase I SipW -
  P5655_RS10510 (P5655_10510) tapA 1919211..1919972 (-) 762 WP_004399106.1 amyloid fiber anchoring/assembly protein TapA -
  P5655_RS10515 (P5655_10515) yqzG 1920244..1920570 (+) 327 WP_003246051.1 YqzG/YhdC family protein -
  P5655_RS10520 (P5655_10520) spoIITA 1920612..1920791 (-) 180 WP_003230176.1 YqzE family protein -
  P5655_RS10525 (P5655_10525) comGG 1920862..1921236 (-) 375 WP_003230170.1 ComG operon protein ComGG Machinery gene
  P5655_RS10530 (P5655_10530) comGF 1921237..1921620 (-) 384 WP_003230168.1 ComG operon protein ComGF Machinery gene
  P5655_RS10535 (P5655_10535) comGE 1921646..1921993 (-) 348 WP_003230165.1 ComG operon protein 5 Machinery gene
  P5655_RS10540 (P5655_10540) comGD 1921977..1922408 (-) 432 WP_004398628.1 comG operon protein ComGD Machinery gene
  P5655_RS10545 (P5655_10545) comGC 1922398..1922694 (-) 297 WP_003230162.1 comG operon protein ComGC Machinery gene
  P5655_RS10550 (P5655_10550) comGB 1922708..1923745 (-) 1038 WP_009967727.1 comG operon protein ComGB Machinery gene
  P5655_RS10555 (P5655_10555) comGA 1923732..1924802 (-) 1071 WP_004399124.1 competence protein ComGA Machinery gene
  P5655_RS10560 (P5655_10560) corA 1925214..1926167 (-) 954 WP_004399136.1 magnesium transporter CorA -

Sequence


Protein


Download         Length: 127 a.a.        Molecular weight: 14281.37 Da        Isoelectric Point: 5.8929

>NTDB_id=733864 P5655_RS10530 WP_003230168.1 1921237..1921620(-) (comGF) [Bacillus subtilis strain DSM 10]
MLISGSLAAIIHLFLSRQQEHDGFTQQEWMISIEQMMNECKESQAVKTAEHGSVLICTNLSGQDIRFDIYHSMIRKRVDG
KGHVPILDHITAMKADIENGVVLLKIESEDQKVYQTAFPVYSYLGGG

Nucleotide


Download         Length: 384 bp        

>NTDB_id=733864 P5655_RS10530 WP_003230168.1 1921237..1921620(-) (comGF) [Bacillus subtilis strain DSM 10]
TTGCTCATATCAGGATCGTTAGCTGCGATTATCCATCTGTTTTTGTCTCGACAGCAGGAACATGACGGTTTCACACAGCA
GGAATGGATGATTTCGATAGAACAGATGATGAATGAATGCAAGGAATCACAGGCAGTTAAGACAGCCGAGCATGGGAGCG
TGTTAATCTGCACCAATCTTTCCGGACAAGACATCCGTTTTGACATTTATCATTCAATGATAAGAAAAAGAGTGGATGGC
AAAGGGCATGTTCCGATTTTAGATCATATTACTGCCATGAAAGCTGATATTGAAAATGGTGTTGTTTTGCTGAAAATTGA
GAGTGAAGACCAAAAAGTGTATCAAACTGCTTTTCCAGTCTATTCGTATTTAGGAGGGGGGTGA


Secondary structure


Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure


Source ID Structure
  AlphaFold DB P25958

Transmembrane helices


Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.



Visualization of predicted probability:


Similar proteins


Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  comGF Bacillus subtilis subsp. subtilis str. 168

100

100

1