Detailed information    

insolico Bioinformatically predicted

Overview

Name   degQ   Type   Regulator
Locus tag   N7980_RS04955 Genome accession   NZ_CP106671
Coordinates   980613..980753 (+) Length   46 a.a.
NCBI ID   WP_003220708.1    Uniprot ID   G4P060
Organism   Bacillus subtilis strain SRCM116301     
Function   modification of regulators (predicted from homology)   
Competence regulation

Genomic Context

Location: 975613..985753
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  N7980_RS04925 (N7980_04925) yueI 975906..976304 (+) 399 WP_032726794.1 YueI family protein -
  N7980_RS04930 (N7980_04930) pncA 976401..976952 (+) 552 WP_043940186.1 cysteine hydrolase family protein -
  N7980_RS04935 (N7980_04935) pncB 976968..978440 (+) 1473 WP_003228788.1 nicotinate phosphoribosyltransferase -
  N7980_RS04940 (N7980_04940) pdeH 978577..979806 (+) 1230 WP_003243525.1 cyclic di-GMP phosphodiesterase -
  N7980_RS04945 (N7980_04945) - 979782..980150 (-) 369 WP_041850584.1 hypothetical protein -
  N7980_RS04950 (N7980_04950) - 980329..980391 (-) 63 Protein_982 hypothetical protein -
  N7980_RS04955 (N7980_04955) degQ 980613..980753 (+) 141 WP_003220708.1 degradation enzyme regulation protein DegQ Regulator
  N7980_RS04960 (N7980_04960) - 980937..981797 (+) 861 WP_041850585.1 polyprenyl synthetase family protein -
  N7980_RS04965 (N7980_04965) comX 981810..981974 (+) 165 WP_015384519.1 competence pheromone ComX -
  N7980_RS04970 (N7980_04970) comP 981986..984286 (+) 2301 WP_088300729.1 histidine kinase Regulator
  N7980_RS04975 (N7980_04975) comA 984367..985011 (+) 645 WP_003220716.1 two-component system response regulator ComA Regulator
  N7980_RS04980 (N7980_04980) yuxO 985030..985410 (+) 381 WP_003228810.1 hotdog fold thioesterase -

Sequence

Protein


Download         Length: 46 a.a.        Molecular weight: 5546.44 Da        Isoelectric Point: 6.2559

>NTDB_id=733862 N7980_RS04955 WP_003220708.1 980613..980753(+) (degQ) [Bacillus subtilis strain SRCM116301]
MEKKLEEVKQLLFRLELDIKETTDSLRNINKSIDQLDKYNYAMKIS

Nucleotide


Download         Length: 141 bp        

>NTDB_id=733862 N7980_RS04955 WP_003220708.1 980613..980753(+) (degQ) [Bacillus subtilis strain SRCM116301]
ATGGAAAAGAAACTTGAAGAAGTAAAACAATTGTTATTCCGACTCGAACTTGATATTAAAGAAACGACAGATTCATTACG
AAACATTAACAAAAGCATTGATCAACTCGATAAATACAATTATGCAATGAAAATTTCGTGA

Domains

Predicted by InterproScan.

DegQ (SacQ) family (DegQ)

(1-46)


Secondary structure

Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure

Source ID Structure
  AlphaFold DB G4P060

Transmembrane helices

Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.


Visualization of predicted probability:


Similar proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  degQ Bacillus subtilis subsp. subtilis str. 168

100

100

1