Detailed information    

insolico Bioinformatically predicted

Overview

Name   degQ   Type   Regulator
Locus tag   N7921_RS15580 Genome accession   NZ_CP106652
Coordinates   2971805..2971945 (-) Length   46 a.a.
NCBI ID   WP_003213123.1    Uniprot ID   A0A5K1N966
Organism   Bacillus safensis strain 33.4     
Function   modification of regulators (predicted from homology)   
Competence regulation

Genomic Context

Location: 2966805..2976945
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  N7921_RS15555 (N7921_15555) - 2967070..2967459 (-) 390 WP_095409463.1 hotdog fold thioesterase -
  N7921_RS15560 (N7921_15560) comA 2967483..2968124 (-) 642 WP_144472265.1 response regulator transcription factor Regulator
  N7921_RS15565 (N7921_15565) comP 2968205..2970517 (-) 2313 WP_144483383.1 ATP-binding protein Regulator
  N7921_RS15570 (N7921_15570) - 2970575..2970742 (-) 168 WP_186318690.1 competence pheromone ComX -
  N7921_RS15575 (N7921_15575) - 2970739..2971653 (-) 915 WP_144483387.1 polyprenyl synthetase family protein -
  N7921_RS15580 (N7921_15580) degQ 2971805..2971945 (-) 141 WP_003213123.1 degradation enzyme regulation protein DegQ Regulator
  N7921_RS15585 (N7921_15585) - 2972451..2972807 (+) 357 WP_144483390.1 inner spore coat protein -
  N7921_RS15590 (N7921_15590) - 2972841..2974067 (-) 1227 WP_144484294.1 EAL and HDOD domain-containing protein -
  N7921_RS15595 (N7921_15595) - 2974205..2975677 (-) 1473 WP_144483393.1 nicotinate phosphoribosyltransferase -
  N7921_RS15600 (N7921_15600) - 2975695..2976246 (-) 552 WP_095409470.1 cysteine hydrolase family protein -
  N7921_RS15605 (N7921_15605) - 2976307..2976714 (-) 408 WP_144483396.1 YueI family protein -

Sequence

Protein


Download         Length: 46 a.a.        Molecular weight: 5677.42 Da        Isoelectric Point: 4.6828

>NTDB_id=733736 N7921_RS15580 WP_003213123.1 2971805..2971945(-) (degQ) [Bacillus safensis strain 33.4]
MEKYEIEELKQLLWKLENEIRETTASLHNINKSIDQYDKYEYVKIS

Nucleotide


Download         Length: 141 bp        

>NTDB_id=733736 N7921_RS15580 WP_003213123.1 2971805..2971945(-) (degQ) [Bacillus safensis strain 33.4]
ATGGAAAAGTATGAAATCGAAGAACTTAAACAATTATTATGGAAACTTGAAAACGAAATTAGAGAAACAACGGCTTCTCT
TCATAACATTAACAAAAGCATTGATCAATACGACAAATATGAATATGTGAAAATTTCTTAA

Domains

Predicted by InterproScan.

DegQ (SacQ) family (DegQ)

(1-46)


Secondary structure

Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure

Source ID Structure
  AlphaFold DB A0A5K1N966

Transmembrane helices

Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.


Visualization of predicted probability:


Similar proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  degQ Bacillus subtilis subsp. subtilis str. 168

68.085

100

0.696