Detailed information    

insolico Bioinformatically predicted

Overview


Name   sinI   Type   Regulator
Locus tag   P5622_RS12310 Genome accession   NZ_CP120598
Coordinates   2321564..2321737 (-) Length   57 a.a.
NCBI ID   WP_003230187.1    Uniprot ID   A0ABU0V3E4
Organism   Bacillus subtilis strain PRO115     
Function   inhibit the expression of sinR (predicted from homology)   
Competence regulation

Genomic Context


Location: 2316564..2326737
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  P5622_RS12260 (P5622_12260) comGE 2316916..2317263 (+) 348 WP_003230165.1 ComG operon protein 5 Machinery gene
  P5622_RS12265 (P5622_12265) comGF 2317289..2317672 (+) 384 WP_003230168.1 ComG operon protein ComGF Machinery gene
  P5622_RS12270 (P5622_12270) comGG 2317673..2318047 (+) 375 WP_003230170.1 ComG operon protein ComGG Machinery gene
  P5622_RS12275 (P5622_12275) spoIIT 2318118..2318297 (+) 180 WP_003230176.1 YqzE family protein -
  P5622_RS12280 (P5622_12280) - 2318339..2318650 (-) 312 WP_347176576.1 DUF3889 domain-containing protein -
  P5622_RS12290 (P5622_12290) tapA 2318936..2319697 (+) 762 WP_004399106.1 amyloid fiber anchoring/assembly protein TapA -
  P5622_RS12295 (P5622_12295) sipW 2319681..2320253 (+) 573 WP_003246088.1 signal peptidase I -
  P5622_RS12300 (P5622_12300) tasA 2320317..2321102 (+) 786 WP_004398632.1 biofilm matrix protein TasA -
  P5622_RS12305 (P5622_12305) sinR 2321195..2321530 (-) 336 WP_003226345.1 transcriptional regulator SinR Regulator
  P5622_RS12310 (P5622_12310) sinI 2321564..2321737 (-) 174 WP_003230187.1 anti-repressor SinI family protein Regulator
  P5622_RS12315 (P5622_12315) yqhG 2321920..2322714 (-) 795 WP_277687258.1 YqhG family protein -
  P5622_RS12320 (P5622_12320) yqhH 2322735..2324408 (-) 1674 WP_004398544.1 SNF2-related protein -
  P5622_RS12325 (P5622_12325) gcvT 2324850..2325938 (+) 1089 WP_004398598.1 glycine cleavage system aminomethyltransferase GcvT -

Sequence


Protein


Download         Length: 57 a.a.        Molecular weight: 6601.52 Da        Isoelectric Point: 6.7231

>NTDB_id=732848 P5622_RS12310 WP_003230187.1 2321564..2321737(-) (sinI) [Bacillus subtilis strain PRO115]
MKNAKQEHFELDQEWVELMVEAKEANISPEEIRKYLLLNKKSAHPGPAARSHTVNPF

Nucleotide


Download         Length: 174 bp        

>NTDB_id=732848 P5622_RS12310 WP_003230187.1 2321564..2321737(-) (sinI) [Bacillus subtilis strain PRO115]
ATGAAGAATGCAAAACAAGAGCACTTTGAATTGGATCAAGAATGGGTTGAATTAATGGTGGAAGCCAAAGAGGCAAATAT
CAGCCCGGAAGAAATACGAAAATATTTACTTTTAAACAAAAAGTCTGCTCATCCTGGTCCGGCAGCCAGAAGTCATACCG
TAAATCCTTTCTGA

Domains


Predicted by InterProScan.

(11-36)


Secondary structure


Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure


Source ID Structure

Transmembrane helices


Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.



Visualization of predicted probability:


Similar proteins


Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  sinI Bacillus subtilis subsp. subtilis str. 168

100

100

1