Detailed information    

insolico Bioinformatically predicted

Overview


Name   comGF   Type   Machinery gene
Locus tag   P5622_RS12265 Genome accession   NZ_CP120598
Coordinates   2317289..2317672 (+) Length   127 a.a.
NCBI ID   WP_003230168.1    Uniprot ID   P25958
Organism   Bacillus subtilis strain PRO115     
Function   dsDNA binding to the cell surface; assembly of the pseudopilus (predicted from homology)   
DNA binding and uptake

Genomic Context


Location: 2312289..2322672
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  P5622_RS12235 (P5622_12235) corA 2312741..2313694 (+) 954 WP_004399136.1 magnesium transporter CorA -
  P5622_RS12240 (P5622_12240) comGA 2314107..2315177 (+) 1071 WP_004399124.1 competence protein ComGA Machinery gene
  P5622_RS12245 (P5622_12245) comGB 2315164..2316201 (+) 1038 WP_009967727.1 comG operon protein ComGB Machinery gene
  P5622_RS12250 (P5622_12250) comGC 2316215..2316511 (+) 297 WP_003230162.1 comG operon protein ComGC Machinery gene
  P5622_RS12255 (P5622_12255) comGD 2316501..2316932 (+) 432 WP_004398628.1 comG operon protein ComGD Machinery gene
  P5622_RS12260 (P5622_12260) comGE 2316916..2317263 (+) 348 WP_003230165.1 ComG operon protein 5 Machinery gene
  P5622_RS12265 (P5622_12265) comGF 2317289..2317672 (+) 384 WP_003230168.1 ComG operon protein ComGF Machinery gene
  P5622_RS12270 (P5622_12270) comGG 2317673..2318047 (+) 375 WP_003230170.1 ComG operon protein ComGG Machinery gene
  P5622_RS12275 (P5622_12275) spoIIT 2318118..2318297 (+) 180 WP_003230176.1 YqzE family protein -
  P5622_RS12280 (P5622_12280) - 2318339..2318650 (-) 312 WP_347176576.1 DUF3889 domain-containing protein -
  P5622_RS12290 (P5622_12290) tapA 2318936..2319697 (+) 762 WP_004399106.1 amyloid fiber anchoring/assembly protein TapA -
  P5622_RS12295 (P5622_12295) sipW 2319681..2320253 (+) 573 WP_003246088.1 signal peptidase I -
  P5622_RS12300 (P5622_12300) tasA 2320317..2321102 (+) 786 WP_004398632.1 biofilm matrix protein TasA -
  P5622_RS12305 (P5622_12305) sinR 2321195..2321530 (-) 336 WP_003226345.1 transcriptional regulator SinR Regulator
  P5622_RS12310 (P5622_12310) sinI 2321564..2321737 (-) 174 WP_003230187.1 anti-repressor SinI family protein Regulator

Sequence


Protein


Download         Length: 127 a.a.        Molecular weight: 14281.37 Da        Isoelectric Point: 5.8929

>NTDB_id=732845 P5622_RS12265 WP_003230168.1 2317289..2317672(+) (comGF) [Bacillus subtilis strain PRO115]
MLISGSLAAIIHLFLSRQQEHDGFTQQEWMISIEQMMNECKESQAVKTAEHGSVLICTNLSGQDIRFDIYHSMIRKRVDG
KGHVPILDHITAMKADIENGVVLLKIESEDQKVYQTAFPVYSYLGGG

Nucleotide


Download         Length: 384 bp        

>NTDB_id=732845 P5622_RS12265 WP_003230168.1 2317289..2317672(+) (comGF) [Bacillus subtilis strain PRO115]
TTGCTCATATCAGGATCGTTAGCTGCGATTATCCATCTGTTTTTGTCTCGACAGCAGGAACATGACGGTTTCACACAGCA
GGAATGGATGATTTCGATAGAACAGATGATGAATGAATGCAAGGAATCACAGGCAGTTAAGACAGCCGAGCATGGGAGCG
TGTTAATCTGCACCAATCTTTCCGGACAAGACATCCGTTTTGACATTTATCATTCAATGATAAGAAAAAGAGTGGATGGC
AAAGGGCATGTTCCGATTTTAGATCATATTACTGCCATGAAAGCTGATATTGAAAATGGTGTTGTTTTGCTGAAAATTGA
GAGTGAAGACCAAAAAGTGTATCAAACTGCTTTTCCAGTCTATTCGTATTTAGGAGGGGGGTGA


Secondary structure


Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure


Source ID Structure
  AlphaFold DB P25958

Transmembrane helices


Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.



Visualization of predicted probability:


Similar proteins


Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  comGF Bacillus subtilis subsp. subtilis str. 168

100

100

1