Detailed information    

insolico Bioinformatically predicted

Overview


Name   degQ   Type   Regulator
Locus tag   P5628_RS16280 Genome accession   NZ_CP120577
Coordinates   3106182..3106322 (-) Length   46 a.a.
NCBI ID   WP_003220708.1    Uniprot ID   G4P060
Organism   Bacillus subtilis strain PRO53     
Function   modification of regulators (predicted from homology)   
Competence regulation

Genomic Context


Location: 3101182..3111322
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  P5628_RS16255 (P5628_16255) yuxO 3101504..3101884 (-) 381 WP_014477831.1 hotdog fold thioesterase -
  P5628_RS16260 (P5628_16260) comA 3101903..3102547 (-) 645 WP_003220716.1 two-component system response regulator ComA Regulator
  P5628_RS16265 (P5628_16265) comP 3102628..3104946 (-) 2319 WP_161621287.1 sensor histidine kinase Regulator
  P5628_RS16270 (P5628_16270) comX 3104966..3105142 (-) 177 WP_041906074.1 competence pheromone ComX -
  P5628_RS16275 (P5628_16275) comQ 3105157..3105996 (-) 840 WP_347176368.1 polyprenyl synthetase family protein Regulator
  P5628_RS16280 (P5628_16280) degQ 3106182..3106322 (-) 141 WP_003220708.1 degradation enzyme regulation protein DegQ Regulator
  P5628_RS16285 (P5628_16285) - 3106544..3106669 (+) 126 WP_161621781.1 hypothetical protein -
  P5628_RS16290 (P5628_16290) - 3106785..3107153 (+) 369 WP_017695529.1 hypothetical protein -
  P5628_RS16295 (P5628_16295) pdeH 3107129..3108358 (-) 1230 WP_003243525.1 cyclic di-GMP phosphodiesterase -
  P5628_RS16300 (P5628_16300) pncB 3108495..3109967 (-) 1473 WP_003228788.1 nicotinate phosphoribosyltransferase -
  P5628_RS16305 (P5628_16305) pncA 3109983..3110534 (-) 552 WP_088326850.1 isochorismatase family cysteine hydrolase -
  P5628_RS16310 (P5628_16310) yueI 3110631..3111029 (-) 399 WP_014480710.1 YueI family protein -

Sequence


Protein


Download         Length: 46 a.a.        Molecular weight: 5546.44 Da        Isoelectric Point: 6.2559

>NTDB_id=732738 P5628_RS16280 WP_003220708.1 3106182..3106322(-) (degQ) [Bacillus subtilis strain PRO53]
MEKKLEEVKQLLFRLELDIKETTDSLRNINKSIDQLDKYNYAMKIS

Nucleotide


Download         Length: 141 bp        

>NTDB_id=732738 P5628_RS16280 WP_003220708.1 3106182..3106322(-) (degQ) [Bacillus subtilis strain PRO53]
ATGGAAAAGAAACTTGAAGAAGTAAAACAATTGTTATTCCGACTCGAACTTGATATTAAAGAAACGACAGATTCATTACG
AAACATTAACAAAAGCATTGATCAACTCGATAAATACAATTATGCAATGAAAATTTCGTGA

Domains


Predicted by InterProScan.

(1-46)


Secondary structure


Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure


Source ID Structure
  AlphaFold DB G4P060

Transmembrane helices


Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.



Visualization of predicted probability:


Similar proteins


Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  degQ Bacillus subtilis subsp. subtilis str. 168

100

100

1