Detailed information    

insolico Bioinformatically predicted

Overview

Name   sinI   Type   Regulator
Locus tag   N6G78_RS12175 Genome accession   NZ_CP104855
Coordinates   2373101..2373274 (+) Length   57 a.a.
NCBI ID   WP_003230187.1    Uniprot ID   A0A063X7W9
Organism   Bacillus subtilis strain TY-1     
Function   inhibit the expression of sinR (predicted from homology)   
Competence regulation

Genomic Context

Location: 2368101..2378274
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  N6G78_RS12160 (N6G78_12160) gcvT 2368900..2369988 (-) 1089 WP_015384081.1 glycine cleavage system aminomethyltransferase GcvT -
  N6G78_RS12165 (N6G78_12165) hepAA 2370430..2372103 (+) 1674 WP_015384082.1 DEAD/DEAH box helicase -
  N6G78_RS12170 (N6G78_12170) yqhG 2372124..2372918 (+) 795 WP_003230200.1 YqhG family protein -
  N6G78_RS12175 (N6G78_12175) sinI 2373101..2373274 (+) 174 WP_003230187.1 anti-repressor SinI Regulator
  N6G78_RS12180 (N6G78_12180) sinR 2373308..2373643 (+) 336 WP_003226345.1 transcriptional regulator SinR Regulator
  N6G78_RS12185 (N6G78_12185) tasA 2373736..2374521 (-) 786 WP_003230183.1 biofilm matrix protein TasA -
  N6G78_RS12190 (N6G78_12190) sipW 2374585..2375157 (-) 573 WP_080030740.1 signal peptidase I SipW -
  N6G78_RS12195 (N6G78_12195) tapA 2375141..2375902 (-) 762 WP_015384085.1 amyloid fiber anchoring/assembly protein TapA -
  N6G78_RS12200 (N6G78_12200) yqzG 2376172..2376498 (+) 327 WP_015384086.1 YqzG/YhdC family protein -
  N6G78_RS12205 (N6G78_12205) spoIITA 2376540..2376719 (-) 180 WP_003230176.1 YqzE family protein -
  N6G78_RS12210 (N6G78_12210) comGG 2376791..2377165 (-) 375 WP_014480253.1 ComG operon protein ComGG Machinery gene
  N6G78_RS12215 (N6G78_12215) comGF 2377166..2377549 (-) 384 WP_015384087.1 ComG operon protein ComGF Machinery gene
  N6G78_RS12220 (N6G78_12220) comGE 2377575..2377922 (-) 348 WP_015384088.1 ComG operon protein 5 Machinery gene

Sequence

Protein


Download         Length: 57 a.a.        Molecular weight: 6601.52 Da        Isoelectric Point: 6.7231

>NTDB_id=732703 N6G78_RS12175 WP_003230187.1 2373101..2373274(+) (sinI) [Bacillus subtilis strain TY-1]
MKNAKQEHFELDQEWVELMVEAKEANISPEEIRKYLLLNKKSAHPGPAARSHTVNPF

Nucleotide


Download         Length: 174 bp        

>NTDB_id=732703 N6G78_RS12175 WP_003230187.1 2373101..2373274(+) (sinI) [Bacillus subtilis strain TY-1]
ATGAAGAATGCAAAACAAGAGCACTTTGAATTGGATCAAGAATGGGTTGAATTAATGGTGGAAGCCAAAGAGGCAAATAT
CAGCCCGGAAGAAATACGAAAATATTTACTTTTAAACAAAAAGTCTGCTCATCCTGGTCCGGCAGCCAGAAGTCATACCG
TAAATCCTTTCTGA

Domains

Predicted by InterproScan.

Anti-repressor SinI (SinI)

(11-36)


Secondary structure

Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure

Source ID Structure
  AlphaFold DB A0A063X7W9

Transmembrane helices

Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.


Visualization of predicted probability:


Similar proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  sinI Bacillus subtilis subsp. subtilis str. 168

100

100

1