Detailed information    

insolico Bioinformatically predicted

Overview


Name   sinI   Type   Regulator
Locus tag   P5628_RS12315 Genome accession   NZ_CP120577
Coordinates   2380307..2380480 (+) Length   57 a.a.
NCBI ID   WP_014477323.1    Uniprot ID   -
Organism   Bacillus subtilis strain PRO53     
Function   inhibit the expression of sinR (predicted from homology)   
Competence regulation

Genomic Context


Location: 2375307..2385480
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  P5628_RS12300 (P5628_12300) gcvT 2376105..2377193 (-) 1089 WP_038829737.1 glycine cleavage system aminomethyltransferase GcvT -
  P5628_RS12305 (P5628_12305) yqhH 2377635..2379308 (+) 1674 WP_038829735.1 SNF2-related protein -
  P5628_RS12310 (P5628_12310) yqhG 2379329..2380123 (+) 795 WP_021480015.1 YqhG family protein -
  P5628_RS12315 (P5628_12315) sinI 2380307..2380480 (+) 174 WP_014477323.1 anti-repressor SinI family protein Regulator
  P5628_RS12320 (P5628_12320) sinR 2380514..2380849 (+) 336 WP_003226345.1 transcriptional regulator SinR Regulator
  P5628_RS12325 (P5628_12325) tasA 2380941..2381726 (-) 786 WP_014477324.1 biofilm matrix protein TasA -
  P5628_RS12330 (P5628_12330) sipW 2381791..2382363 (-) 573 WP_086344613.1 signal peptidase I -
  P5628_RS12335 (P5628_12335) tapA 2382347..2383108 (-) 762 WP_277708795.1 amyloid fiber anchoring/assembly protein TapA -
  P5628_RS12340 (P5628_12340) yqzG 2383379..2383705 (+) 327 WP_021480018.1 YqzG/YhdC family protein -
  P5628_RS12345 (P5628_12345) spoIIT 2383747..2383926 (-) 180 WP_014480252.1 YqzE family protein -
  P5628_RS12350 (P5628_12350) comGG 2383998..2384372 (-) 375 WP_064671036.1 ComG operon protein ComGG Machinery gene
  P5628_RS12355 (P5628_12355) comGF 2384373..2384756 (-) 384 WP_032726158.1 ComG operon protein ComGF Machinery gene
  P5628_RS12360 (P5628_12360) comGE 2384782..2385129 (-) 348 WP_063335293.1 ComG operon protein 5 Machinery gene

Sequence


Protein


Download         Length: 57 a.a.        Molecular weight: 6633.58 Da        Isoelectric Point: 6.7231

>NTDB_id=732701 P5628_RS12315 WP_014477323.1 2380307..2380480(+) (sinI) [Bacillus subtilis strain PRO53]
MKNAKQEHFELDQEWVELMMEAKEANISPEEIRKYLLLNKKSAHPGPAARSHTVNPF

Nucleotide


Download         Length: 174 bp        

>NTDB_id=732701 P5628_RS12315 WP_014477323.1 2380307..2380480(+) (sinI) [Bacillus subtilis strain PRO53]
ATGAAAAATGCAAAACAAGAGCACTTTGAATTGGATCAAGAATGGGTTGAATTGATGATGGAAGCCAAAGAGGCAAATAT
CAGCCCGGAAGAAATACGAAAATATTTACTTTTAAACAAAAAGTCTGCTCATCCTGGTCCGGCAGCCAGAAGTCATACCG
TAAATCCTTTCTGA

Domains


Predicted by InterProScan.

(11-36)


Secondary structure


Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure


Source ID Structure

Transmembrane helices


Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.



Visualization of predicted probability:


Similar proteins


Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  sinI Bacillus subtilis subsp. subtilis str. 168

98.246

100

0.982