Detailed information NTG0731241

Bioinformatically predicted

Overview

• Name: comE
• Type: Machinery gene
• Locus tag: N5980_RS02030
• Genome accession: NZ_CP104651
• Coordinates: 435514..435984 (+)
• Length: 156 a.a.
• NCBI ID: WP_180004773.1
• Uniprot ID: -
• Organism: Acinetobacter variabilis strain 2021CK-01005
• Function: assembly of type IV pilus (predicted from homology) DNA binding and uptake

Related MGE

Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.

Gene-MGE association summary

MGE type	MGE coordinates	Gene coordinates	Relative position	Distance (bp)
Genomic island	420535..436452	435514..435984	within	0

Gene organization within MGE regions

Location: 420535..436452

Locus tag	Gene name	Coordinates (strand)	Size (bp)	Protein ID	Product	Description
N5980_RS01960 (N5980_01960)	tfpZ	420535..421269 (+)	735	Protein_375	TfpX/TfpZ family type IV pilin accessory protein	-
N5980_RS01965 (N5980_01965)	-	421422..423059 (+)	1638	WP_261635303.1	PglL family O-oligosaccharyltransferase	-
N5980_RS01970 (N5980_01970)	bfr	423115..423579 (-)	465	WP_261635304.1	heteropolymeric bacterioferritin subunit Bfr	-
N5980_RS01975 (N5980_01975)	-	423806..424000 (-)	195	WP_004787097.1	bacterioferritin-associated ferredoxin	-
N5980_RS01980 (N5980_01980)	-	424222..424605 (-)	384	WP_005233608.1	RidA family protein	-
N5980_RS01985 (N5980_01985)	-	424681..426786 (-)	2106	WP_261635305.1	RelA/SpoT family protein	-
N5980_RS01990 (N5980_01990)	rpoZ	427004..427285 (-)	282	WP_004650579.1	DNA-directed RNA polymerase subunit omega	-
N5980_RS01995 (N5980_01995)	gmk	427363..427986 (-)	624	WP_004787090.1	guanylate kinase	-
N5980_RS02000 (N5980_02000)	ispH	428122..429072 (+)	951	WP_261635306.1	4-hydroxy-3-methylbut-2-enyl diphosphate reductase	-
N5980_RS02005 (N5980_02005)	-	429236..429688 (+)	453	WP_261635307.1	pilus assembly FimT family protein	-
N5980_RS02010 (N5980_02010)	pilV	429688..430188 (+)	501	WP_180004777.1	type IV pilus modification protein PilV	-
N5980_RS02015 (N5980_02015)	-	430189..431121 (+)	933	WP_261635308.1	PilW family protein	-
N5980_RS02020 (N5980_02020)	-	431111..431830 (+)	720	WP_261635309.1	pilus assembly PilX family protein	-
N5980_RS02025 (N5980_02025)	-	431841..435500 (+)	3660	WP_261635310.1	pilus assembly protein PilY	-
N5980_RS02030 (N5980_02030)	comE	435514..435984 (+)	471	WP_180004773.1	type IV pilin protein	Machinery gene
N5980_RS02035 (N5980_02035)	-	435985..436452 (+)	468	WP_261635311.1	type IV pilin protein	-

Sequence

Protein

• Length: 156 a.a.
• Molecular weight: 17073.36 Da
• Isoelectric Point: 9.0291

>NTDB_id=731241 N5980_RS02030 WP_180004773.1 435514..435984(+) (comE) [Acinetobacter variabilis strain 2021CK-01005]
MIKDKFSGFTLIELMVVVVIVAIFAAIAIPSYQEYVRRAHASQAQQEMMHLSSLLERHKARNFSYRNFTPSAVVIPEGAT
GSAIKYNIEVVSGDNSNPLLNASTATGRSWVIRGLSTDTQNYSFLLTSTGIRCKNKAAENVSFTSCGNTNSGSETW

Nucleotide

• Length: 471 bp

>NTDB_id=731241 N5980_RS02030 WP_180004773.1 435514..435984(+) (comE) [Acinetobacter variabilis strain 2021CK-01005]
ATGATTAAAGACAAATTCTCTGGGTTTACGCTTATAGAATTGATGGTGGTTGTGGTGATTGTTGCAATATTTGCAGCAAT
CGCTATTCCCTCTTATCAAGAATATGTACGACGTGCACACGCAAGTCAGGCCCAACAAGAGATGATGCATCTTTCTAGCT
TGTTAGAAAGACATAAGGCTAGAAATTTTTCTTATAGGAATTTTACTCCTTCTGCTGTGGTTATTCCAGAAGGTGCGACT
GGAAGTGCCATCAAATATAATATAGAAGTTGTTAGCGGAGATAATAGTAACCCTCTGCTAAATGCATCTACTGCAACTGG
TCGTAGTTGGGTTATTAGGGGATTGAGTACGGATACTCAAAACTATTCATTTTTACTAACAAGTACAGGCATTCGTTGTA
AGAACAAAGCAGCAGAAAACGTTAGTTTTACAAGCTGTGGAAATACTAACTCTGGTAGTGAGACATGGTAA

Domains

Predicted by InterproScan.

• Prokaryotic N-terminal methylation motif (N_methyl) (5-28)

• Type IV minor pilin ComP, DNA uptake sequence receptor (ComP_DUS) (30-103)

Similar proteins

Only experimentally validated proteins are listed.

Protein	Organism	Identities (%)	Coverage (%)	Ha-value
comE	Acinetobacter baylyi ADP1	48.214	100	0.519
pilY2	Acinetobacter baumannii D1279779	45.161	99.359	0.449