Detailed information    

insolico Bioinformatically predicted

Overview

Name   pilI   Type   Machinery gene
Locus tag   NDL71_RS06300 Genome accession   NZ_CP104546
Coordinates   1172477..1173091 (+) Length   204 a.a.
NCBI ID   WP_012503479.1    Uniprot ID   -
Organism   Neisseria gonorrhoeae strain 9035     
Function   type IV pilus (predicted from homology)   
DNA binding and uptake

Related MGE

Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.

Gene-MGE association summary

MGE type MGE coordinates Gene coordinates Relative position Distance (bp)
Prophage 1160086..1214004 1172477..1173091 within 0


Gene organization within MGE regions


Location: 1160086..1214004
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  NDL71_RS06235 (NDL71_02605) - 1160086..1161069 (+) 984 WP_003687900.1 ribose-phosphate pyrophosphokinase -
  NDL71_RS06240 (NDL71_02610) - 1161136..1161708 (+) 573 WP_003687901.1 50S ribosomal protein L25/general stress protein Ctc -
  NDL71_RS06245 (NDL71_02615) - 1161834..1163003 (-) 1170 WP_003690889.1 D-alanyl-D-alanine carboxypeptidase family protein -
  NDL71_RS06250 (NDL71_02620) ilvA 1163152..1164678 (+) 1527 WP_003690890.1 threonine ammonia-lyase, biosynthetic -
  NDL71_RS06255 (NDL71_02625) - 1164734..1165809 (-) 1076 Protein_1201 sulfate/molybdate ABC transporter ATP-binding protein -
  NDL71_RS06260 (NDL71_02630) - 1165832..1165966 (-) 135 Protein_1202 IS5/IS1182 family transposase -
  NDL71_RS06265 (NDL71_02635) cysW 1165950..1166771 (-) 822 WP_012503473.1 sulfate ABC transporter permease subunit CysW -
  NDL71_RS06270 (NDL71_02640) cysT 1166960..1167789 (-) 830 Protein_1204 sulfate ABC transporter permease subunit CysT -
  NDL71_RS06275 (NDL71_02645) - 1167975..1168307 (+) 333 WP_003687908.1 hypothetical protein -
  NDL71_RS06280 (NDL71_02650) - 1168637..1169146 (+) 510 WP_003687909.1 isoprenylcysteine carboxyl methyltransferase family protein -
  NDL71_RS06285 (NDL71_02655) - 1169378..1169959 (-) 582 WP_003690895.1 superoxide dismutase -
  NDL71_RS06290 (NDL71_02660) dnaB 1170123..1171526 (+) 1404 WP_012503477.1 replicative DNA helicase -
  NDL71_RS12045 - 1171520..1171632 (-) 113 Protein_1209 IS5/IS1182 family transposase -
  NDL71_RS06295 (NDL71_02665) pilH 1171783..1172445 (+) 663 WP_041421240.1 Tfp pilus assembly protein FimT/FimU Machinery gene
  NDL71_RS06300 (NDL71_02670) pilI 1172477..1173091 (+) 615 WP_012503479.1 type IV pilus modification protein PilV Machinery gene
  NDL71_RS06305 (NDL71_02675) pilJ 1173088..1174047 (+) 960 WP_260247272.1 PilW family protein Machinery gene
  NDL71_RS06310 (NDL71_02680) pilK 1174026..1174637 (+) 612 WP_012503481.1 PilX N-terminal domain-containing pilus assembly protein Machinery gene
  NDL71_RS06315 (NDL71_02685) pilL 1174639..1175112 (+) 474 WP_012503482.1 PilX family type IV pilin Machinery gene
  NDL71_RS06320 (NDL71_02690) - 1175182..1175490 (-) 309 WP_003706588.1 AzlD family protein -
  NDL71_RS06325 (NDL71_02695) - 1175487..1176198 (-) 712 Protein_1216 AzlC family ABC transporter permease -
  NDL71_RS06330 (NDL71_02700) dut 1176364..1176816 (+) 453 WP_003701071.1 dUTP diphosphatase -
  NDL71_RS06335 (NDL71_02705) dapC 1176888..1178075 (+) 1188 WP_003701073.1 succinyldiaminopimelate transaminase -
  NDL71_RS06340 (NDL71_02710) yaaA 1178231..1179010 (+) 780 WP_003687925.1 peroxide stress protein YaaA -
  NDL71_RS06355 (NDL71_02725) - 1179540..1180741 (+) 1202 Protein_1220 tyrosine-type recombinase/integrase -
  NDL71_RS06360 (NDL71_02730) - 1181097..1181366 (-) 270 WP_003687928.1 hypothetical protein -
  NDL71_RS06365 (NDL71_02735) - 1181561..1182244 (-) 684 WP_003687929.1 DUF2786 domain-containing protein -
  NDL71_RS11870 - 1182525..1182791 (-) 267 Protein_1223 hypothetical protein -
  NDL71_RS06375 (NDL71_02745) - 1182902..1183117 (-) 216 WP_003691538.1 hypothetical protein -
  NDL71_RS06380 (NDL71_02750) - 1183169..1183660 (-) 492 WP_003691537.1 siphovirus Gp157 family protein -
  NDL71_RS06385 (NDL71_02755) - 1183657..1183839 (-) 183 WP_003691535.1 hypothetical protein -
  NDL71_RS06390 (NDL71_02760) - 1183979..1184665 (-) 687 WP_012503754.1 phage replication initiation protein, NGO0469 family -
  NDL71_RS06395 (NDL71_02765) - 1184734..1184895 (-) 162 WP_003702497.1 hypothetical protein -
  NDL71_RS06400 (NDL71_02770) - 1184892..1185170 (-) 279 WP_003691529.1 NGO1622 family putative holin -
  NDL71_RS06405 (NDL71_02775) - 1185323..1185655 (-) 333 WP_003687946.1 hypothetical protein -
  NDL71_RS06410 (NDL71_02780) - 1185796..1186077 (-) 282 WP_262668621.1 hypothetical protein -
  NDL71_RS06415 (NDL71_02785) - 1186074..1186550 (-) 477 WP_002255718.1 DUF6948 domain-containing protein -
  NDL71_RS06420 (NDL71_02790) - 1186583..1186783 (-) 201 WP_003692842.1 hypothetical protein -
  NDL71_RS06425 (NDL71_02795) - 1186982..1187395 (-) 414 WP_003687963.1 hypothetical protein -
  NDL71_RS06430 (NDL71_02800) - 1187392..1187853 (-) 462 WP_003687965.1 helix-turn-helix domain-containing protein -
  NDL71_RS06435 (NDL71_02805) - 1187870..1188307 (-) 438 WP_003687967.1 hypothetical protein -
  NDL71_RS06440 (NDL71_02810) - 1188422..1189138 (-) 717 WP_003687969.1 LexA family transcriptional regulator -
  NDL71_RS06445 (NDL71_02815) - 1189213..1189443 (+) 231 WP_020997318.1 transcriptional regulator -
  NDL71_RS06450 (NDL71_02820) - 1189523..1189678 (+) 156 WP_003691446.1 hypothetical protein -
  NDL71_RS06455 (NDL71_02825) - 1189655..1189843 (-) 189 WP_003698903.1 hypothetical protein -
  NDL71_RS06460 (NDL71_02830) - 1190016..1190243 (+) 228 WP_003698261.1 helix-turn-helix domain-containing protein -
  NDL71_RS06465 (NDL71_02835) - 1190240..1190377 (+) 138 WP_010359998.1 hypothetical protein -
  NDL71_RS06470 (NDL71_02840) - 1190361..1191425 (+) 1065 WP_003689134.1 hypothetical protein -
  NDL71_RS06475 (NDL71_02845) - 1191422..1192783 (+) 1362 WP_003689132.1 DnaB-like helicase C-terminal domain-containing protein -
  NDL71_RS06480 (NDL71_02850) - 1192800..1193030 (+) 231 WP_012503490.1 hypothetical protein -
  NDL71_RS06485 (NDL71_02855) - 1193122..1193616 (+) 495 WP_041421248.1 DUF3310 domain-containing protein -
  NDL71_RS06490 (NDL71_02860) - 1194000..1194149 (+) 150 WP_012503493.1 hypothetical protein -
  NDL71_RS06495 (NDL71_02865) - 1194178..1194459 (+) 282 WP_003689109.1 hypothetical protein -
  NDL71_RS06500 (NDL71_02870) - 1194450..1194887 (+) 438 WP_041421250.1 RusA family crossover junction endodeoxyribonuclease -
  NDL71_RS06505 (NDL71_02875) - 1194880..1195185 (+) 306 WP_003687981.1 nuclease domain-containing protein -
  NDL71_RS06510 (NDL71_02880) - 1195182..1195565 (+) 384 WP_003687982.1 recombination protein NinB -
  NDL71_RS06515 (NDL71_02885) - 1195556..1196074 (+) 519 WP_003687984.1 HNH endonuclease -
  NDL71_RS06520 (NDL71_02890) - 1196139..1196561 (+) 423 WP_003690919.1 hypothetical protein -
  NDL71_RS06525 (NDL71_02895) - 1196561..1197100 (+) 540 WP_003690920.1 hypothetical protein -
  NDL71_RS06530 (NDL71_02900) - 1197081..1198355 (+) 1275 WP_003701186.1 PBSX family phage terminase large subunit -
  NDL71_RS06535 (NDL71_02905) - 1198340..1200607 (+) 2268 WP_228369784.1 hypothetical protein -
  NDL71_RS06540 (NDL71_02910) - 1200844..1202040 (+) 1197 WP_003687992.1 hypothetical protein -
  NDL71_RS06545 (NDL71_02915) - 1202037..1203251 (+) 1215 WP_044270986.1 hypothetical protein -
  NDL71_RS12050 - 1203454..1209363 (+) 5910 WP_033909227.1 PLxRFG domain-containing protein -
  NDL71_RS06560 (NDL71_02930) - 1209989..1211275 (+) 1287 WP_071200297.1 DUF4043 family protein -
  NDL71_RS06565 (NDL71_02935) - 1211330..1211803 (+) 474 WP_003690936.1 hypothetical protein -
  NDL71_RS06570 (NDL71_02940) - 1211809..1212294 (+) 486 WP_003687997.1 hypothetical protein -
  NDL71_RS06575 (NDL71_02945) - 1212291..1212566 (+) 276 WP_010358526.1 hypothetical protein -
  NDL71_RS06580 (NDL71_02950) - 1212557..1212964 (+) 408 WP_010358525.1 hypothetical protein -
  NDL71_RS06585 (NDL71_02955) - 1212967..1213116 (+) 150 WP_003706419.1 hypothetical protein -
  NDL71_RS06590 (NDL71_02960) - 1213153..1214004 (-) 852 WP_260247274.1 Bro-N domain-containing protein -

Sequence

Protein


Download         Length: 204 a.a.        Molecular weight: 22099.99 Da        Isoelectric Point: 4.9673

>NTDB_id=730331 NDL71_RS06300 WP_012503479.1 1172477..1173091(+) (pilI) [Neisseria gonorrhoeae strain 9035]
MKNNDCLRLKNPQSGMALIEVLVAMLVLTIGILALLSVQLRTVASVREAETQTIVSQITQNLMEGMLMNPTIDSDSNKKN
YNLYTGPYTPTPSGGDFKLNNNNLISKKDLAKAQLDRFDYELRNALPDAVAIHYAVCKDSSGGAPTLSGGTFSPNCDNKA
NGDTLIKVLWVNDSAGDSDISRTNLEVSGDNIVYTYQARVGGHE

Nucleotide


Download         Length: 615 bp        

>NTDB_id=730331 NDL71_RS06300 WP_012503479.1 1172477..1173091(+) (pilI) [Neisseria gonorrhoeae strain 9035]
ATGAAGAATAATGATTGCTTGCGCCTGAAAAATCCCCAGTCCGGTATGGCGTTGATAGAAGTCTTGGTCGCTATGCTCGT
TCTGACCATCGGTATTTTGGCATTGCTGTCCGTACAGTTGCGGACGGTCGCTTCCGTCAGGGAGGCGGAGACACAAACCA
TCGTCAGCCAAATCACGCAAAACCTGATGGAAGGAATGTTGATGAATCCGACCATTGATTCGGACAGCAACAAGAAAAAC
TATAATCTTTACACGGGGCCGTACACCCCCACTCCCTCTGGCGGCGATTTCAAGCTTAATAATAATAATTTGATAAGTAA
GAAGGATTTGGCAAAAGCCCAGTTGGACAGGTTCGATTATGAATTGAGAAACGCCTTGCCGGATGCGGTAGCTATTCATT
ACGCCGTCTGCAAGGATTCGTCGGGTGGCGCGCCGACATTGTCCGGCGGTACTTTTTCTCCAAATTGCGATAATAAGGCA
AACGGGGATACTTTGATTAAAGTATTGTGGGTAAATGATTCGGCAGGGGATTCGGATATTTCCCGTACGAATCTTGAGGT
GAGCGGCGACAATATCGTATATACCTATCAGGCAAGGGTCGGAGGTCATGAATGA

Domains

Predicted by InterproScan.

Prokaryotic N-terminal methylation motif (N_methyl)

(11-36)


Secondary structure

Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure

Source ID Structure

Transmembrane helices

Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.


Visualization of predicted probability:


Similar proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  pilI Neisseria gonorrhoeae MS11

90.686

100

0.907
  pilV Neisseria gonorrhoeae MS11

90.686

100

0.907
  pilV Neisseria meningitidis 8013

84.135

100

0.858