Detailed information
Bioinformatically predicted
Overview
| Name | ssbA | Type | Machinery gene |
| Locus tag | N1060_RS04125 | Genome accession | NZ_CP104478 |
| Coordinates | 849371..849814 (+) | Length | 147 a.a. |
| NCBI ID | WP_001099009.1 | Uniprot ID | A0A0C6EXF8 |
| Organism | Staphylococcus aureus strain DSM 20231 | ||
| Function | ssDNA binding (predicted from homology) DNA processing |
||
Related MGE
Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.
Gene-MGE association summary
| MGE type | MGE coordinates | Gene coordinates | Relative position | Distance (bp) |
|---|---|---|---|---|
| Prophage | 839710..884787 | 849371..849814 | within | 0 |
Gene organization within MGE regions
Location: 839710..884787
| Locus tag | Gene name | Coordinates (strand) | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| N1060_RS04040 (N1060_04040) | sufB | 839710..841107 (+) | 1398 | WP_001074405.1 | Fe-S cluster assembly protein SufB | - |
| N1060_RS04045 (N1060_04045) | - | 841175..842224 (-) | 1050 | WP_001145725.1 | tyrosine-type recombinase/integrase | - |
| N1060_RS04050 (N1060_04050) | - | 842336..842536 (+) | 201 | WP_000143212.1 | excisionase | - |
| N1060_RS04055 (N1060_04055) | - | 842473..843378 (-) | 906 | WP_000391592.1 | hypothetical protein | - |
| N1060_RS04060 (N1060_04060) | - | 843410..844135 (-) | 726 | WP_000661437.1 | PH domain-containing protein | - |
| N1060_RS04065 (N1060_04065) | - | 844163..844837 (-) | 675 | WP_000775187.1 | ImmA/IrrE family metallo-endopeptidase | - |
| N1060_RS04070 (N1060_04070) | - | 844854..845186 (-) | 333 | WP_001055143.1 | helix-turn-helix domain-containing protein | - |
| N1060_RS04075 (N1060_04075) | - | 845449..845643 (+) | 195 | WP_000108122.1 | helix-turn-helix domain-containing protein | - |
| N1060_RS04080 (N1060_04080) | - | 845643..846410 (+) | 768 | WP_001002757.1 | phage antirepressor Ant | - |
| N1060_RS04085 (N1060_04085) | tscA | 846411..846635 (+) | 225 | WP_000187184.1 | type II toxin-antitoxin system antitoxin TscA | - |
| N1060_RS04090 (N1060_04090) | - | 846675..847124 (+) | 450 | WP_001836220.1 | hypothetical protein | - |
| N1060_RS04095 (N1060_04095) | - | 847138..847359 (+) | 222 | WP_000977381.1 | hypothetical protein | - |
| N1060_RS04100 (N1060_04100) | - | 847352..847513 (+) | 162 | WP_000066011.1 | DUF1270 domain-containing protein | - |
| N1060_RS04105 (N1060_04105) | - | 847607..847909 (+) | 303 | WP_000165363.1 | DUF2482 family protein | - |
| N1060_RS04110 (N1060_04110) | - | 847914..848174 (+) | 261 | WP_001836221.1 | DUF1108 family protein | - |
| N1060_RS04115 (N1060_04115) | - | 848187..848723 (+) | 537 | WP_001004336.1 | host-nuclease inhibitor Gam family protein | - |
| N1060_RS04120 (N1060_04120) | - | 848724..849374 (+) | 651 | WP_000840496.1 | ERF family protein | - |
| N1060_RS04125 (N1060_04125) | ssbA | 849371..849814 (+) | 444 | WP_001099009.1 | single-stranded DNA-binding protein | Machinery gene |
| N1060_RS04130 (N1060_04130) | - | 849826..850500 (+) | 675 | WP_000057263.1 | putative HNHc nuclease | - |
| N1060_RS04135 (N1060_04135) | - | 850497..850646 (+) | 150 | WP_001081076.1 | hypothetical protein | - |
| N1060_RS04140 (N1060_04140) | - | 850639..850920 (-) | 282 | WP_000414755.1 | hypothetical protein | - |
| N1060_RS04145 (N1060_04145) | - | 850986..851756 (+) | 771 | WP_001836222.1 | conserved phage C-terminal domain-containing protein | - |
| N1060_RS04150 (N1060_04150) | - | 851766..852545 (+) | 780 | WP_000803062.1 | ATP-binding protein | - |
| N1060_RS04155 (N1060_04155) | - | 852539..852697 (+) | 159 | WP_000256589.1 | hypothetical protein | - |
| N1060_RS04160 (N1060_04160) | - | 852710..852931 (+) | 222 | WP_001123695.1 | DUF3269 family protein | - |
| N1060_RS04165 (N1060_04165) | - | 852941..853345 (+) | 405 | WP_001836225.1 | DUF1064 domain-containing protein | - |
| N1060_RS04170 (N1060_04170) | - | 853350..853535 (+) | 186 | WP_001187243.1 | DUF3113 family protein | - |
| N1060_RS04175 (N1060_04175) | - | 853536..853841 (+) | 306 | WP_000101252.1 | hypothetical protein | - |
| N1060_RS04180 (N1060_04180) | - | 853969..854325 (+) | 357 | WP_000029376.1 | SA1788 family PVL leukocidin-associated protein | - |
| N1060_RS04185 (N1060_04185) | - | 854329..854571 (+) | 243 | WP_001562543.1 | SAV1978 family virulence-associated passenger protein | - |
| N1060_RS04190 (N1060_04190) | - | 854580..854951 (+) | 372 | WP_001557190.1 | hypothetical protein | - |
| N1060_RS04195 (N1060_04195) | - | 854944..855195 (+) | 252 | WP_001836226.1 | DUF1024 family protein | - |
| N1060_RS04200 (N1060_04200) | - | 855185..855367 (+) | 183 | WP_000028421.1 | hypothetical protein | - |
| N1060_RS04205 (N1060_04205) | - | 855360..855890 (+) | 531 | WP_000185651.1 | dUTP diphosphatase | - |
| N1060_RS04210 (N1060_04210) | - | 855927..856133 (+) | 207 | WP_000195785.1 | DUF1381 domain-containing protein | - |
| N1060_RS04215 (N1060_04215) | - | 856130..856324 (+) | 195 | WP_000132920.1 | hypothetical protein | - |
| N1060_RS04220 (N1060_04220) | - | 856321..856524 (+) | 204 | WP_001072794.1 | hypothetical protein | - |
| N1060_RS04225 (N1060_04225) | rinB | 856517..856690 (+) | 174 | WP_001657250.1 | transcriptional activator RinB | - |
| N1060_RS04230 (N1060_04230) | - | 856691..856837 (+) | 147 | WP_000990005.1 | hypothetical protein | - |
| N1060_RS04235 (N1060_04235) | - | 856861..857283 (+) | 423 | WP_000162701.1 | RinA family phage transcriptional activator | - |
| N1060_RS04240 (N1060_04240) | - | 857471..857965 (+) | 495 | WP_001038244.1 | terminase small subunit | - |
| N1060_RS04245 (N1060_04245) | - | 857968..859263 (+) | 1296 | WP_001836232.1 | PBSX family phage terminase large subunit | - |
| N1060_RS04250 (N1060_04250) | - | 859274..860812 (+) | 1539 | WP_000909970.1 | phage portal protein | - |
| N1060_RS04255 (N1060_04255) | - | 860819..861814 (+) | 996 | WP_001133044.1 | minor capsid protein | - |
| N1060_RS04260 (N1060_04260) | - | 861887..862057 (+) | 171 | WP_000072208.1 | hypothetical protein | - |
| N1060_RS04265 (N1060_04265) | - | 862085..862172 (+) | 88 | Protein_829 | hypothetical protein | - |
| N1060_RS04270 (N1060_04270) | - | 862166..862786 (+) | 621 | WP_000392146.1 | DUF4355 domain-containing protein | - |
| N1060_RS04275 (N1060_04275) | - | 862800..863774 (+) | 975 | WP_001836233.1 | phage major capsid protein | - |
| N1060_RS04280 (N1060_04280) | - | 863796..864083 (+) | 288 | WP_001836234.1 | hypothetical protein | - |
| N1060_RS04285 (N1060_04285) | - | 864092..864424 (+) | 333 | WP_000208960.1 | phage head-tail connector protein | - |
| N1060_RS04290 (N1060_04290) | - | 864421..864723 (+) | 303 | WP_025175363.1 | hypothetical protein | - |
| N1060_RS04295 (N1060_04295) | - | 864723..865070 (+) | 348 | WP_001017815.1 | HK97-gp10 family putative phage morphogenesis protein | - |
| N1060_RS04300 (N1060_04300) | - | 865082..865465 (+) | 384 | Protein_836 | hypothetical protein | - |
| N1060_RS04305 (N1060_04305) | - | 865484..866065 (+) | 582 | WP_000002577.1 | phage major tail protein, TP901-1 family | - |
| N1060_RS04310 (N1060_04310) | - | 866127..866492 (+) | 366 | WP_001100161.1 | tail assembly chaperone | - |
| N1060_RS04315 (N1060_04315) | - | 866522..866866 (+) | 345 | WP_000105584.1 | hypothetical protein | - |
| N1060_RS04320 (N1060_04320) | - | 866883..870350 (+) | 3468 | WP_000141480.1 | hypothetical protein | - |
| N1060_RS04325 (N1060_04325) | - | 870363..871310 (+) | 948 | WP_000350675.1 | phage tail family protein | - |
| N1060_RS04330 (N1060_04330) | - | 871319..873217 (+) | 1899 | WP_000152718.1 | SGNH/GDSL hydrolase family protein | - |
| N1060_RS04335 (N1060_04335) | - | 873232..875142 (+) | 1911 | WP_001836235.1 | hypothetical protein | - |
| N1060_RS04340 (N1060_04340) | - | 875142..876965 (+) | 1824 | WP_000634521.1 | phage baseplate upper protein | - |
| N1060_RS04345 (N1060_04345) | - | 876965..877342 (+) | 378 | WP_000705896.1 | DUF2977 domain-containing protein | - |
| N1060_RS04350 (N1060_04350) | - | 877346..877519 (+) | 174 | WP_000782200.1 | XkdX family protein | - |
| N1060_RS04355 (N1060_04355) | - | 877559..877858 (+) | 300 | WP_000466777.1 | DUF2951 domain-containing protein | - |
| N1060_RS04360 (N1060_04360) | - | 877995..879893 (+) | 1899 | WP_001836236.1 | N-acetylglucosaminidase | - |
| N1060_RS04365 (N1060_04365) | - | 879906..881144 (+) | 1239 | WP_000276662.1 | BppU family phage baseplate upper protein | - |
| N1060_RS04370 (N1060_04370) | - | 881150..881545 (+) | 396 | WP_000398872.1 | hypothetical protein | - |
| N1060_RS04375 (N1060_04375) | - | 881601..881876 (+) | 276 | WP_000351119.1 | phage holin | - |
| N1060_RS04380 (N1060_04380) | - | 881863..883275 (+) | 1413 | WP_001141517.1 | N-acetylmuramoyl-L-alanine amidase | - |
| N1060_RS04385 (N1060_04385) | - | 883335..883892 (-) | 558 | WP_001035620.1 | DUF4888 domain-containing protein | - |
| N1060_RS04390 (N1060_04390) | - | 884267..884419 (+) | 153 | WP_001788502.1 | hypothetical protein | - |
| N1060_RS04395 (N1060_04395) | - | 884490..884600 (+) | 111 | WP_000139423.1 | hypothetical protein | - |
| N1060_RS04400 (N1060_04400) | - | 884602..884787 (+) | 186 | WP_001286805.1 | hypothetical protein | - |
Sequence
Protein
Download Length: 147 a.a. Molecular weight: 16321.89 Da Isoelectric Point: 5.8347
>NTDB_id=729871 N1060_RS04125 WP_001099009.1 849371..849814(+) (ssbA) [Staphylococcus aureus strain DSM 20231]
MNTVNLIGNLVADPELKGQNNNVVNFVIAVQRPFKNKQTNEYETDFIRCVAFGKTAEIIANNFNKGNKIGVTGSIQTGSY
ENNQGQKVFTTDIAVNNITFVERKNNGQSNNQQQHNSYNAPQNRQQSNNPFANANGPIEISDDDLPF
MNTVNLIGNLVADPELKGQNNNVVNFVIAVQRPFKNKQTNEYETDFIRCVAFGKTAEIIANNFNKGNKIGVTGSIQTGSY
ENNQGQKVFTTDIAVNNITFVERKNNGQSNNQQQHNSYNAPQNRQQSNNPFANANGPIEISDDDLPF
Nucleotide
Download Length: 444 bp
>NTDB_id=729871 N1060_RS04125 WP_001099009.1 849371..849814(+) (ssbA) [Staphylococcus aureus strain DSM 20231]
ATGAATACAGTAAATTTAATTGGGAACCTAGTGGCAGATCCAGAGTTAAAAGGTCAAAACAACAACGTAGTTAACTTTGT
AATCGCAGTACAGAGACCATTCAAAAACAAACAAACTAACGAATATGAAACAGACTTCATTCGTTGTGTTGCATTTGGTA
AGACTGCTGAAATCATCGCTAATAACTTTAATAAAGGTAATAAAATTGGCGTTACTGGTTCAATACAAACCGGTAGTTAT
GAAAATAATCAAGGACAGAAAGTGTTTACTACAGACATCGCAGTCAACAATATAACTTTCGTTGAACGTAAAAACAACGG
TCAATCTAACAACCAACAACAGCATAATTCATATAACGCACCACAGAATAGACAGCAATCAAATAATCCATTTGCTAATG
CTAATGGTCCTATAGAAATCTCTGACGATGATTTACCTTTCTAG
ATGAATACAGTAAATTTAATTGGGAACCTAGTGGCAGATCCAGAGTTAAAAGGTCAAAACAACAACGTAGTTAACTTTGT
AATCGCAGTACAGAGACCATTCAAAAACAAACAAACTAACGAATATGAAACAGACTTCATTCGTTGTGTTGCATTTGGTA
AGACTGCTGAAATCATCGCTAATAACTTTAATAAAGGTAATAAAATTGGCGTTACTGGTTCAATACAAACCGGTAGTTAT
GAAAATAATCAAGGACAGAAAGTGTTTACTACAGACATCGCAGTCAACAATATAACTTTCGTTGAACGTAAAAACAACGG
TCAATCTAACAACCAACAACAGCATAATTCATATAACGCACCACAGAATAGACAGCAATCAAATAATCCATTTGCTAATG
CTAATGGTCCTATAGAAATCTCTGACGATGATTTACCTTTCTAG
Similar proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|---|---|---|---|
| ssbA | Bacillus subtilis subsp. subtilis str. 168 |
41.279 |
100 |
0.483 |
| ssb | Latilactobacillus sakei subsp. sakei 23K |
38.235 |
100 |
0.442 |