Detailed information    

insolico Bioinformatically predicted

Overview

Name   comGD   Type   Machinery gene
Locus tag   N4R43_RS01340 Genome accession   NZ_CP104388
Coordinates   234269..234628 (-) Length   119 a.a.
NCBI ID   WP_023188582.1    Uniprot ID   -
Organism   Lactococcus lactis strain LJL7m20     
Function   dsDNA binding to the cell surface; assembly of the pseudopilus (predicted from homology)   
DNA binding and uptake

Related MGE

Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.

Gene-MGE association summary

MGE type MGE coordinates Gene coordinates Relative position Distance (bp)
Prophage 230997..271010 234269..234628 within 0


Gene organization within MGE regions


Location: 230997..271010
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  N4R43_RS01310 (N4R43_01310) - 230997..231734 (-) 738 WP_012898617.1 metal ABC transporter ATP-binding protein -
  N4R43_RS01315 (N4R43_01315) - 231911..232753 (-) 843 WP_015427160.1 metal ABC transporter substrate-binding protein -
  N4R43_RS01320 (N4R43_01320) - 232750..233187 (-) 438 WP_003129992.1 zinc-dependent MarR family transcriptional regulator -
  N4R43_RS01325 (N4R43_01325) comGG 233269..233553 (-) 285 WP_025017139.1 competence type IV pilus minor pilin ComGG Machinery gene
  N4R43_RS01330 (N4R43_01330) comGF 233592..234038 (-) 447 WP_029344525.1 competence type IV pilus minor pilin ComGF Machinery gene
  N4R43_RS01335 (N4R43_01335) comGE 234001..234297 (-) 297 WP_058223572.1 competence type IV pilus minor pilin ComGE Machinery gene
  N4R43_RS01340 (N4R43_01340) comGD 234269..234628 (-) 360 WP_023188582.1 competence type IV pilus minor pilin ComGD Machinery gene
  N4R43_RS01345 (N4R43_01345) comGC 234660..234956 (-) 297 WP_167593410.1 competence type IV pilus major pilin ComGC Machinery gene
  N4R43_RS01350 (N4R43_01350) - 235120..235245 (-) 126 WP_317141343.1 hypothetical protein -
  N4R43_RS01355 (N4R43_01355) - 235255..236034 (-) 780 WP_317141344.1 peptidoglycan amidohydrolase family protein -
  N4R43_RS01360 (N4R43_01360) - 236034..236321 (-) 288 WP_317141345.1 phage holin -
  N4R43_RS01365 (N4R43_01365) - 236335..236559 (-) 225 WP_010905920.1 hemolysin XhlA family protein -
  N4R43_RS01370 (N4R43_01370) - 236572..236808 (-) 237 WP_317141346.1 hypothetical protein -
  N4R43_RS12325 - 237353..238099 (-) 747 Protein_263 serine/threonine protein phosphatase -
  N4R43_RS01380 (N4R43_01380) - 238122..238295 (-) 174 WP_096819001.1 hypothetical protein -
  N4R43_RS01385 (N4R43_01385) - 238295..239416 (-) 1122 WP_317141347.1 hypothetical protein -
  N4R43_RS01390 (N4R43_01390) - 239432..241219 (-) 1788 WP_317141348.1 hypothetical protein -
  N4R43_RS01395 (N4R43_01395) - 241219..242742 (-) 1524 WP_317141349.1 distal tail protein Dit -
  N4R43_RS01400 (N4R43_01400) - 242756..245359 (-) 2604 WP_317141350.1 phage tail tape measure protein -
  N4R43_RS01405 (N4R43_01405) - 245349..246056 (-) 708 WP_317141351.1 Gp15 family bacteriophage protein -
  N4R43_RS01410 (N4R43_01410) - 246072..246479 (-) 408 WP_029344314.1 hypothetical protein -
  N4R43_RS01415 (N4R43_01415) - 246536..247015 (-) 480 WP_256294074.1 phage tail tube protein -
  N4R43_RS01420 (N4R43_01420) - 247028..247462 (-) 435 WP_317141352.1 minor capsid protein -
  N4R43_RS01425 (N4R43_01425) - 247462..247791 (-) 330 WP_317141353.1 hypothetical protein -
  N4R43_RS01430 (N4R43_01430) - 247788..248132 (-) 345 WP_003131319.1 putative minor capsid protein -
  N4R43_RS01435 (N4R43_01435) - 248122..248523 (-) 402 WP_317141354.1 hypothetical protein -
  N4R43_RS01440 (N4R43_01440) - 248580..248813 (-) 234 WP_153927504.1 Ig domain-containing protein -
  N4R43_RS01445 (N4R43_01445) - 248842..249759 (-) 918 WP_317141355.1 phage capsid protein -
  N4R43_RS01450 (N4R43_01450) - 249774..250835 (-) 1062 WP_317141356.1 XkdF-like putative serine protease domain-containing protein -
  N4R43_RS01455 (N4R43_01455) - 250851..251681 (-) 831 WP_317141357.1 phage minor head protein -
  N4R43_RS01460 (N4R43_01460) - 251674..253203 (-) 1530 WP_317141358.1 phage portal protein -
  N4R43_RS01465 (N4R43_01465) terL 253216..254667 (-) 1452 WP_317141359.1 phage terminase large subunit -
  N4R43_RS12330 - 254648..255457 (-) 810 WP_376716683.1 HNH endonuclease -
  N4R43_RS01480 (N4R43_01480) - 255629..256018 (-) 390 WP_317141360.1 DUF722 domain-containing protein -
  N4R43_RS01485 (N4R43_01485) - 256097..256300 (-) 204 WP_270329675.1 hypothetical protein -
  N4R43_RS01490 (N4R43_01490) - 256301..256603 (-) 303 WP_317141361.1 hypothetical protein -
  N4R43_RS01495 (N4R43_01495) - 256731..256862 (+) 132 WP_165379799.1 MucR family transcriptional regulator -
  N4R43_RS01500 (N4R43_01500) - 257175..257342 (-) 168 WP_201179682.1 hypothetical protein -
  N4R43_RS01505 (N4R43_01505) - 257403..257561 (-) 159 WP_317141362.1 DUF1660 domain-containing protein -
  N4R43_RS01510 (N4R43_01510) - 257558..257788 (-) 231 WP_317141363.1 hypothetical protein -
  N4R43_RS01515 (N4R43_01515) - 257916..258254 (+) 339 WP_317141364.1 winged helix-turn-helix domain-containing protein -
  N4R43_RS01520 (N4R43_01520) - 258288..258632 (-) 345 WP_317141365.1 hypothetical protein -
  N4R43_RS01525 (N4R43_01525) - 258644..258844 (-) 201 WP_216793441.1 hypothetical protein -
  N4R43_RS01530 (N4R43_01530) - 258837..259115 (-) 279 WP_216793439.1 hypothetical protein -
  N4R43_RS01535 (N4R43_01535) - 259129..259266 (-) 138 Protein_294 aminotransferase -
  N4R43_RS01540 (N4R43_01540) - 259263..259916 (-) 654 WP_317141366.1 DUF1642 domain-containing protein -
  N4R43_RS01545 (N4R43_01545) - 259909..260202 (-) 294 WP_317141367.1 hypothetical protein -
  N4R43_RS01550 (N4R43_01550) - 260199..260615 (-) 417 WP_317141368.1 YopX family protein -
  N4R43_RS01555 (N4R43_01555) - 260624..260830 (-) 207 WP_014570535.1 hypothetical protein -
  N4R43_RS01560 (N4R43_01560) - 260938..261357 (-) 420 WP_317141369.1 RusA family crossover junction endodeoxyribonuclease -
  N4R43_RS01565 (N4R43_01565) - 261366..261608 (-) 243 WP_317141370.1 hypothetical protein -
  N4R43_RS01570 (N4R43_01570) - 261601..262524 (-) 924 WP_317141371.1 phage replisome organizer N-terminal domain-containing protein -
  N4R43_RS01575 (N4R43_01575) - 262799..263815 (-) 1017 WP_317141372.1 DUF1351 domain-containing protein -
  N4R43_RS01580 (N4R43_01580) - 263817..264683 (-) 867 WP_317141373.1 recombinase RecT -
  N4R43_RS01585 (N4R43_01585) - 264784..264957 (-) 174 WP_014573167.1 putative transcriptional regulator -
  N4R43_RS01590 (N4R43_01590) - 264989..265174 (-) 186 WP_038600407.1 hypothetical protein -
  N4R43_RS01595 (N4R43_01595) - 265187..265309 (-) 123 WP_023164646.1 hypothetical protein -
  N4R43_RS01600 (N4R43_01600) - 265306..265488 (-) 183 WP_003130605.1 hypothetical protein -
  N4R43_RS01605 (N4R43_01605) - 265504..266220 (-) 717 WP_317141374.1 phage antirepressor KilAC domain-containing protein -
  N4R43_RS01610 (N4R43_01610) - 266266..266487 (-) 222 WP_317141375.1 helix-turn-helix transcriptional regulator -
  N4R43_RS01615 (N4R43_01615) - 266643..267065 (+) 423 WP_317141376.1 helix-turn-helix transcriptional regulator -
  N4R43_RS01620 (N4R43_01620) - 267076..267660 (+) 585 WP_288625240.1 hypothetical protein -
  N4R43_RS01625 (N4R43_01625) - 267715..268254 (+) 540 WP_023164651.1 PH domain-containing protein -
  N4R43_RS01630 (N4R43_01630) - 268380..269838 (+) 1459 Protein_313 recombinase family protein -

Sequence

Protein


Download         Length: 119 a.a.        Molecular weight: 13717.95 Da        Isoelectric Point: 7.9853

>NTDB_id=729313 N4R43_RS01340 WP_023188582.1 234269..234628(-) (comGD) [Lactococcus lactis strain LJL7m20]
MLIISFITTLFSSEIIQTVHLFKGELFVLQFENFYKRSQEEAALLQKSESLVAKNQELICEDRSITIPKEVAVKDFTVKF
DDKGENSSLQKLTISLPYEKKFITYQLEIGSGKFKKKIS

Nucleotide


Download         Length: 360 bp        

>NTDB_id=729313 N4R43_RS01340 WP_023188582.1 234269..234628(-) (comGD) [Lactococcus lactis strain LJL7m20]
TTGTTGATTATTTCTTTTATCACAACTCTTTTTTCTTCAGAAATAATACAAACAGTCCATCTTTTTAAGGGAGAATTGTT
TGTTCTTCAATTTGAAAATTTCTATAAAAGGAGTCAAGAAGAGGCTGCACTGCTTCAAAAATCTGAAAGTTTAGTTGCTA
AAAATCAAGAATTAATCTGTGAAGATAGAAGTATCACAATTCCAAAGGAGGTAGCAGTTAAAGATTTTACAGTTAAATTT
GATGATAAGGGAGAGAATTCTAGCTTACAAAAACTCACAATTTCTTTACCTTACGAAAAAAAGTTCATCACTTATCAATT
GGAGATAGGCAGTGGAAAATTTAAAAAGAAAATCAGTTAA

Domains


No domain identified.



Secondary structure

Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure

Source ID Structure

Transmembrane helices

Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.


Visualization of predicted probability:


Similar proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  comGD Lactococcus lactis subsp. cremoris KW2

65.812

98.319

0.647
  comYD Streptococcus mutans UA140

36.752

98.319

0.361
  comYD Streptococcus mutans UA159

36.752

98.319

0.361