Detailed information
Overview
| Name | comGG | Type | Machinery gene |
| Locus tag | N4R43_RS01325 | Genome accession | NZ_CP104388 |
| Coordinates | 233269..233553 (-) | Length | 94 a.a. |
| NCBI ID | WP_025017139.1 | Uniprot ID | - |
| Organism | Lactococcus lactis strain LJL7m20 | ||
| Function | dsDNA binding to the cell surface; assembly of the pseudopilus (predicted from homology) DNA binding and uptake |
||
Related MGE
Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.
Gene-MGE association summary
| MGE type | MGE coordinates | Gene coordinates | Relative position | Distance (bp) |
|---|---|---|---|---|
| Prophage | 230997..271010 | 233269..233553 | within | 0 |
Gene organization within MGE regions
Location: 230997..271010
| Locus tag | Gene name | Coordinates (strand) | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| N4R43_RS01310 (N4R43_01310) | - | 230997..231734 (-) | 738 | WP_012898617.1 | metal ABC transporter ATP-binding protein | - |
| N4R43_RS01315 (N4R43_01315) | - | 231911..232753 (-) | 843 | WP_015427160.1 | metal ABC transporter substrate-binding protein | - |
| N4R43_RS01320 (N4R43_01320) | - | 232750..233187 (-) | 438 | WP_003129992.1 | zinc-dependent MarR family transcriptional regulator | - |
| N4R43_RS01325 (N4R43_01325) | comGG | 233269..233553 (-) | 285 | WP_025017139.1 | competence type IV pilus minor pilin ComGG | Machinery gene |
| N4R43_RS01330 (N4R43_01330) | comGF | 233592..234038 (-) | 447 | WP_029344525.1 | competence type IV pilus minor pilin ComGF | Machinery gene |
| N4R43_RS01335 (N4R43_01335) | comGE | 234001..234297 (-) | 297 | WP_058223572.1 | competence type IV pilus minor pilin ComGE | Machinery gene |
| N4R43_RS01340 (N4R43_01340) | comGD | 234269..234628 (-) | 360 | WP_023188582.1 | competence type IV pilus minor pilin ComGD | Machinery gene |
| N4R43_RS01345 (N4R43_01345) | comGC | 234660..234956 (-) | 297 | WP_167593410.1 | competence type IV pilus major pilin ComGC | Machinery gene |
| N4R43_RS01350 (N4R43_01350) | - | 235120..235245 (-) | 126 | WP_317141343.1 | hypothetical protein | - |
| N4R43_RS01355 (N4R43_01355) | - | 235255..236034 (-) | 780 | WP_317141344.1 | peptidoglycan amidohydrolase family protein | - |
| N4R43_RS01360 (N4R43_01360) | - | 236034..236321 (-) | 288 | WP_317141345.1 | phage holin | - |
| N4R43_RS01365 (N4R43_01365) | - | 236335..236559 (-) | 225 | WP_010905920.1 | hemolysin XhlA family protein | - |
| N4R43_RS01370 (N4R43_01370) | - | 236572..236808 (-) | 237 | WP_317141346.1 | hypothetical protein | - |
| N4R43_RS12325 | - | 237353..238099 (-) | 747 | Protein_263 | serine/threonine protein phosphatase | - |
| N4R43_RS01380 (N4R43_01380) | - | 238122..238295 (-) | 174 | WP_096819001.1 | hypothetical protein | - |
| N4R43_RS01385 (N4R43_01385) | - | 238295..239416 (-) | 1122 | WP_317141347.1 | hypothetical protein | - |
| N4R43_RS01390 (N4R43_01390) | - | 239432..241219 (-) | 1788 | WP_317141348.1 | hypothetical protein | - |
| N4R43_RS01395 (N4R43_01395) | - | 241219..242742 (-) | 1524 | WP_317141349.1 | distal tail protein Dit | - |
| N4R43_RS01400 (N4R43_01400) | - | 242756..245359 (-) | 2604 | WP_317141350.1 | phage tail tape measure protein | - |
| N4R43_RS01405 (N4R43_01405) | - | 245349..246056 (-) | 708 | WP_317141351.1 | Gp15 family bacteriophage protein | - |
| N4R43_RS01410 (N4R43_01410) | - | 246072..246479 (-) | 408 | WP_029344314.1 | hypothetical protein | - |
| N4R43_RS01415 (N4R43_01415) | - | 246536..247015 (-) | 480 | WP_256294074.1 | phage tail tube protein | - |
| N4R43_RS01420 (N4R43_01420) | - | 247028..247462 (-) | 435 | WP_317141352.1 | minor capsid protein | - |
| N4R43_RS01425 (N4R43_01425) | - | 247462..247791 (-) | 330 | WP_317141353.1 | hypothetical protein | - |
| N4R43_RS01430 (N4R43_01430) | - | 247788..248132 (-) | 345 | WP_003131319.1 | putative minor capsid protein | - |
| N4R43_RS01435 (N4R43_01435) | - | 248122..248523 (-) | 402 | WP_317141354.1 | hypothetical protein | - |
| N4R43_RS01440 (N4R43_01440) | - | 248580..248813 (-) | 234 | WP_153927504.1 | Ig domain-containing protein | - |
| N4R43_RS01445 (N4R43_01445) | - | 248842..249759 (-) | 918 | WP_317141355.1 | phage capsid protein | - |
| N4R43_RS01450 (N4R43_01450) | - | 249774..250835 (-) | 1062 | WP_317141356.1 | XkdF-like putative serine protease domain-containing protein | - |
| N4R43_RS01455 (N4R43_01455) | - | 250851..251681 (-) | 831 | WP_317141357.1 | phage minor head protein | - |
| N4R43_RS01460 (N4R43_01460) | - | 251674..253203 (-) | 1530 | WP_317141358.1 | phage portal protein | - |
| N4R43_RS01465 (N4R43_01465) | terL | 253216..254667 (-) | 1452 | WP_317141359.1 | phage terminase large subunit | - |
| N4R43_RS12330 | - | 254648..255457 (-) | 810 | WP_376716683.1 | HNH endonuclease | - |
| N4R43_RS01480 (N4R43_01480) | - | 255629..256018 (-) | 390 | WP_317141360.1 | DUF722 domain-containing protein | - |
| N4R43_RS01485 (N4R43_01485) | - | 256097..256300 (-) | 204 | WP_270329675.1 | hypothetical protein | - |
| N4R43_RS01490 (N4R43_01490) | - | 256301..256603 (-) | 303 | WP_317141361.1 | hypothetical protein | - |
| N4R43_RS01495 (N4R43_01495) | - | 256731..256862 (+) | 132 | WP_165379799.1 | MucR family transcriptional regulator | - |
| N4R43_RS01500 (N4R43_01500) | - | 257175..257342 (-) | 168 | WP_201179682.1 | hypothetical protein | - |
| N4R43_RS01505 (N4R43_01505) | - | 257403..257561 (-) | 159 | WP_317141362.1 | DUF1660 domain-containing protein | - |
| N4R43_RS01510 (N4R43_01510) | - | 257558..257788 (-) | 231 | WP_317141363.1 | hypothetical protein | - |
| N4R43_RS01515 (N4R43_01515) | - | 257916..258254 (+) | 339 | WP_317141364.1 | winged helix-turn-helix domain-containing protein | - |
| N4R43_RS01520 (N4R43_01520) | - | 258288..258632 (-) | 345 | WP_317141365.1 | hypothetical protein | - |
| N4R43_RS01525 (N4R43_01525) | - | 258644..258844 (-) | 201 | WP_216793441.1 | hypothetical protein | - |
| N4R43_RS01530 (N4R43_01530) | - | 258837..259115 (-) | 279 | WP_216793439.1 | hypothetical protein | - |
| N4R43_RS01535 (N4R43_01535) | - | 259129..259266 (-) | 138 | Protein_294 | aminotransferase | - |
| N4R43_RS01540 (N4R43_01540) | - | 259263..259916 (-) | 654 | WP_317141366.1 | DUF1642 domain-containing protein | - |
| N4R43_RS01545 (N4R43_01545) | - | 259909..260202 (-) | 294 | WP_317141367.1 | hypothetical protein | - |
| N4R43_RS01550 (N4R43_01550) | - | 260199..260615 (-) | 417 | WP_317141368.1 | YopX family protein | - |
| N4R43_RS01555 (N4R43_01555) | - | 260624..260830 (-) | 207 | WP_014570535.1 | hypothetical protein | - |
| N4R43_RS01560 (N4R43_01560) | - | 260938..261357 (-) | 420 | WP_317141369.1 | RusA family crossover junction endodeoxyribonuclease | - |
| N4R43_RS01565 (N4R43_01565) | - | 261366..261608 (-) | 243 | WP_317141370.1 | hypothetical protein | - |
| N4R43_RS01570 (N4R43_01570) | - | 261601..262524 (-) | 924 | WP_317141371.1 | phage replisome organizer N-terminal domain-containing protein | - |
| N4R43_RS01575 (N4R43_01575) | - | 262799..263815 (-) | 1017 | WP_317141372.1 | DUF1351 domain-containing protein | - |
| N4R43_RS01580 (N4R43_01580) | - | 263817..264683 (-) | 867 | WP_317141373.1 | recombinase RecT | - |
| N4R43_RS01585 (N4R43_01585) | - | 264784..264957 (-) | 174 | WP_014573167.1 | putative transcriptional regulator | - |
| N4R43_RS01590 (N4R43_01590) | - | 264989..265174 (-) | 186 | WP_038600407.1 | hypothetical protein | - |
| N4R43_RS01595 (N4R43_01595) | - | 265187..265309 (-) | 123 | WP_023164646.1 | hypothetical protein | - |
| N4R43_RS01600 (N4R43_01600) | - | 265306..265488 (-) | 183 | WP_003130605.1 | hypothetical protein | - |
| N4R43_RS01605 (N4R43_01605) | - | 265504..266220 (-) | 717 | WP_317141374.1 | phage antirepressor KilAC domain-containing protein | - |
| N4R43_RS01610 (N4R43_01610) | - | 266266..266487 (-) | 222 | WP_317141375.1 | helix-turn-helix transcriptional regulator | - |
| N4R43_RS01615 (N4R43_01615) | - | 266643..267065 (+) | 423 | WP_317141376.1 | helix-turn-helix transcriptional regulator | - |
| N4R43_RS01620 (N4R43_01620) | - | 267076..267660 (+) | 585 | WP_288625240.1 | hypothetical protein | - |
| N4R43_RS01625 (N4R43_01625) | - | 267715..268254 (+) | 540 | WP_023164651.1 | PH domain-containing protein | - |
| N4R43_RS01630 (N4R43_01630) | - | 268380..269838 (+) | 1459 | Protein_313 | recombinase family protein | - |
Sequence
Protein
Download Length: 94 a.a. Molecular weight: 10813.05 Da Isoelectric Point: 5.0604
>NTDB_id=729310 N4R43_RS01325 WP_025017139.1 233269..233553(-) (comGG) [Lactococcus lactis strain LJL7m20]
MFSMFLQFYLERQIDDARQLRSEKEQLTAELMVSVALKTDLKSQGQIHFDSGDLSYNLLTDSSASSKITDHSSDENTYQF
SIHLKDGTNFQIKK
MFSMFLQFYLERQIDDARQLRSEKEQLTAELMVSVALKTDLKSQGQIHFDSGDLSYNLLTDSSASSKITDHSSDENTYQF
SIHLKDGTNFQIKK
Nucleotide
Download Length: 285 bp
>NTDB_id=729310 N4R43_RS01325 WP_025017139.1 233269..233553(-) (comGG) [Lactococcus lactis strain LJL7m20]
ATGTTTTCAATGTTTCTTCAGTTCTATTTGGAAAGGCAAATAGATGATGCTCGACAATTAAGAAGTGAAAAGGAGCAGTT
AACAGCTGAATTAATGGTGTCAGTAGCTTTAAAGACTGATTTAAAATCTCAAGGTCAAATTCATTTTGATTCAGGGGATT
TGTCCTACAATTTACTGACAGACTCGTCAGCTAGTTCAAAAATTACTGACCATTCAAGTGATGAAAATACCTATCAATTT
AGTATCCATCTAAAAGATGGCACAAACTTTCAAATAAAAAAATAA
ATGTTTTCAATGTTTCTTCAGTTCTATTTGGAAAGGCAAATAGATGATGCTCGACAATTAAGAAGTGAAAAGGAGCAGTT
AACAGCTGAATTAATGGTGTCAGTAGCTTTAAAGACTGATTTAAAATCTCAAGGTCAAATTCATTTTGATTCAGGGGATT
TGTCCTACAATTTACTGACAGACTCGTCAGCTAGTTCAAAAATTACTGACCATTCAAGTGATGAAAATACCTATCAATTT
AGTATCCATCTAAAAGATGGCACAAACTTTCAAATAAAAAAATAA
Domains
No domain identified.
3D structure
| Source | ID | Structure |
|---|
Similar proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|---|---|---|---|
| comGG | Lactococcus lactis subsp. cremoris KW2 |
58.511 |
100 |
0.585 |