Detailed information    

insolico Bioinformatically predicted

Overview


Name   sinI   Type   Regulator
Locus tag   N0B18_RS13005 Genome accession   NZ_CP103995
Coordinates   2413974..2414147 (+) Length   57 a.a.
NCBI ID   WP_003230187.1    Uniprot ID   A0A063X7W9
Organism   Bacillus subtilis strain SRCM117109     
Function   inhibit the expression of sinR (predicted from homology)   
Competence regulation

Genomic Context


Location: 2408974..2419147
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  N0B18_RS12990 (N0B18_12990) gcvT 2409773..2410861 (-) 1089 WP_069964209.1 glycine cleavage system aminomethyltransferase GcvT -
  N0B18_RS12995 (N0B18_12995) hepAA 2411303..2412976 (+) 1674 WP_014480248.1 DEAD/DEAH box helicase -
  N0B18_RS13000 (N0B18_13000) yqhG 2412997..2413791 (+) 795 WP_014480249.1 YqhG family protein -
  N0B18_RS13005 (N0B18_13005) sinI 2413974..2414147 (+) 174 WP_003230187.1 anti-repressor SinI Regulator
  N0B18_RS13010 (N0B18_13010) sinR 2414181..2414516 (+) 336 WP_003226345.1 transcriptional regulator SinR Regulator
  N0B18_RS13015 (N0B18_13015) tasA 2414609..2415394 (-) 786 WP_014480250.1 biofilm matrix protein TasA -
  N0B18_RS13020 (N0B18_13020) sipW 2415458..2416030 (-) 573 WP_003230181.1 signal peptidase I SipW -
  N0B18_RS13025 (N0B18_13025) tapA 2416014..2416775 (-) 762 WP_014480251.1 amyloid fiber anchoring/assembly protein TapA -
  N0B18_RS13030 (N0B18_13030) yqzG 2417047..2417373 (+) 327 WP_003246051.1 YqzG/YhdC family protein -
  N0B18_RS13035 (N0B18_13035) spoIITA 2417415..2417594 (-) 180 WP_014480252.1 YqzE family protein -
  N0B18_RS13040 (N0B18_13040) comGG 2417665..2418039 (-) 375 WP_014480253.1 ComG operon protein ComGG Machinery gene
  N0B18_RS13045 (N0B18_13045) comGF 2418040..2418423 (-) 384 WP_014480254.1 ComG operon protein ComGF Machinery gene
  N0B18_RS13050 (N0B18_13050) comGE 2418449..2418796 (-) 348 WP_014480255.1 ComG operon protein 5 Machinery gene

Sequence


Protein


Download         Length: 57 a.a.        Molecular weight: 6601.52 Da        Isoelectric Point: 6.7231

>NTDB_id=726839 N0B18_RS13005 WP_003230187.1 2413974..2414147(+) (sinI) [Bacillus subtilis strain SRCM117109]
MKNAKQEHFELDQEWVELMVEAKEANISPEEIRKYLLLNKKSAHPGPAARSHTVNPF

Nucleotide


Download         Length: 174 bp        

>NTDB_id=726839 N0B18_RS13005 WP_003230187.1 2413974..2414147(+) (sinI) [Bacillus subtilis strain SRCM117109]
ATGAAGAATGCAAAACAAGAGCACTTTGAATTGGATCAAGAATGGGTTGAATTAATGGTGGAAGCCAAAGAGGCAAATAT
CAGCCCGGAAGAAATACGAAAATATTTACTTTTAAACAAAAAGTCTGCTCATCCTGGTCCGGCAGCCAGAAGTCATACCG
TAAATCCTTTCTGA

Domains


Predicted by InterProScan.

(11-36)


Secondary structure


Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure


Source ID Structure

Transmembrane helices


Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.



Visualization of predicted probability:


Similar proteins


Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  sinI Bacillus subtilis subsp. subtilis str. 168

100

100

1