Detailed information    

insolico Bioinformatically predicted

Overview


Name   comGC   Type   Machinery gene
Locus tag   NX081_RS13180 Genome accession   NZ_CP103856
Coordinates   2663266..2663532 (-) Length   88 a.a.
NCBI ID   WP_060562757.1    Uniprot ID   -
Organism   Bacillus velezensis strain SRCM116265     
Function   dsDNA binding to the cell surface; assembly of the pseudopilus (predicted from homology)   
DNA binding and uptake

Genomic Context


Location: 2658266..2668532
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  NX081_RS13130 (NX081_13130) sinR 2658431..2658766 (+) 336 WP_003153104.1 transcriptional regulator SinR Regulator
  NX081_RS13135 (NX081_13135) tasA 2658814..2659599 (-) 786 WP_007408329.1 biofilm matrix protein TasA -
  NX081_RS13140 (NX081_13140) sipW 2659663..2660247 (-) 585 WP_060562614.1 signal peptidase I SipW -
  NX081_RS13145 (NX081_13145) tapA 2660219..2660890 (-) 672 WP_060562615.1 amyloid fiber anchoring/assembly protein TapA -
  NX081_RS13150 (NX081_13150) - 2661149..2661478 (+) 330 WP_060562616.1 DUF3889 domain-containing protein -
  NX081_RS13155 (NX081_13155) - 2661518..2661697 (-) 180 WP_003153093.1 YqzE family protein -
  NX081_RS13160 (NX081_13160) comGG 2661754..2662131 (-) 378 WP_060562617.1 competence type IV pilus minor pilin ComGG Machinery gene
  NX081_RS13165 (NX081_13165) comGF 2662132..2662632 (-) 501 WP_014305411.1 competence type IV pilus minor pilin ComGF -
  NX081_RS13170 (NX081_13170) comGE 2662541..2662855 (-) 315 WP_015388003.1 competence type IV pilus minor pilin ComGE Machinery gene
  NX081_RS13175 (NX081_13175) comGD 2662839..2663276 (-) 438 WP_012117983.1 competence type IV pilus minor pilin ComGD Machinery gene
  NX081_RS13180 (NX081_13180) comGC 2663266..2663532 (-) 267 WP_060562757.1 competence type IV pilus major pilin ComGC Machinery gene
  NX081_RS13185 (NX081_13185) comGB 2663579..2664616 (-) 1038 WP_060562618.1 competence type IV pilus assembly protein ComGB Machinery gene
  NX081_RS13190 (NX081_13190) comGA 2664603..2665673 (-) 1071 WP_007408320.1 competence type IV pilus ATPase ComGA Machinery gene
  NX081_RS13195 (NX081_13195) - 2665866..2666816 (-) 951 WP_007408319.1 magnesium transporter CorA family protein -
  NX081_RS13200 (NX081_13200) - 2666962..2668263 (+) 1302 WP_060562619.1 hemolysin family protein -

Sequence


Protein


Download         Length: 88 a.a.        Molecular weight: 9691.23 Da        Isoelectric Point: 6.2027

>NTDB_id=726094 NX081_RS13180 WP_060562757.1 2663266..2663532(-) (comGC) [Bacillus velezensis strain SRCM116265]
MLIVLFIVSILLLITIPNVTKHNQSIQHKGCEGLQNMVKAQVTAYEIDHEGKTPDMNDLQSEGYIKKNTACPNGKQILIS
GGEVTVEQ

Nucleotide


Download         Length: 267 bp        

>NTDB_id=726094 NX081_RS13180 WP_060562757.1 2663266..2663532(-) (comGC) [Bacillus velezensis strain SRCM116265]
ATGCTGATCGTTTTATTTATCGTTTCCATTCTGCTTTTAATCACCATTCCTAACGTTACAAAACATAATCAAAGCATTCA
GCATAAAGGCTGTGAAGGACTGCAGAATATGGTGAAAGCCCAAGTGACGGCGTACGAAATCGACCATGAAGGTAAAACGC
CGGATATGAACGATTTACAATCAGAGGGGTATATCAAAAAGAATACAGCCTGCCCGAATGGTAAACAGATCTTAATTAGT
GGCGGAGAAGTTACAGTTGAACAATAA

Domains



No domain identified.



Secondary structure


Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure


Source ID Structure

Transmembrane helices


Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.



Visualization of predicted probability:


Similar proteins


Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  comGC Bacillus subtilis subsp. subtilis str. 168

76.056

80.682

0.614