Detailed information    

insolico Bioinformatically predicted

Overview

Name   degQ   Type   Regulator
Locus tag   NYR91_RS15755 Genome accession   NZ_CP103784
Coordinates   3047494..3047634 (-) Length   46 a.a.
NCBI ID   WP_003220708.1    Uniprot ID   G4P060
Organism   Bacillus subtilis strain RO-NN-1     
Function   modification of regulators (predicted from homology)   
Competence regulation

Genomic Context

Location: 3042494..3052634
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  NYR91_RS15730 (NYR91_15730) yuxO 3042844..3043224 (-) 381 WP_014477831.1 hotdog fold thioesterase -
  NYR91_RS15735 (NYR91_15735) comA 3043243..3043887 (-) 645 WP_003220716.1 two-component system response regulator ComA Regulator
  NYR91_RS15740 (NYR91_15740) comP 3043968..3046265 (-) 2298 WP_041519489.1 histidine kinase Regulator
  NYR91_RS15745 (NYR91_15745) comX 3046273..3046434 (-) 162 WP_003241045.1 competence pheromone ComX -
  NYR91_RS15750 (NYR91_15750) - 3046449..3047309 (-) 861 WP_014477833.1 polyprenyl synthetase family protein -
  NYR91_RS15755 (NYR91_15755) degQ 3047494..3047634 (-) 141 WP_003220708.1 degradation enzyme regulation protein DegQ Regulator
  NYR91_RS15760 (NYR91_15760) - 3047856..3047981 (+) 126 WP_154796978.1 hypothetical protein -
  NYR91_RS15765 (NYR91_15765) - 3048095..3048463 (+) 369 WP_014477834.1 hypothetical protein -
  NYR91_RS15770 (NYR91_15770) pdeH 3048439..3049668 (-) 1230 WP_014477835.1 cyclic di-GMP phosphodiesterase -
  NYR91_RS15775 (NYR91_15775) pncB 3049805..3051277 (-) 1473 WP_003228788.1 nicotinate phosphoribosyltransferase -
  NYR91_RS15780 (NYR91_15780) pncA 3051293..3051844 (-) 552 WP_014477836.1 cysteine hydrolase family protein -
  NYR91_RS15785 (NYR91_15785) yueI 3051941..3052339 (-) 399 WP_014477837.1 YueI family protein -

Sequence

Protein


Download         Length: 46 a.a.        Molecular weight: 5546.44 Da        Isoelectric Point: 6.2559

>NTDB_id=725041 NYR91_RS15755 WP_003220708.1 3047494..3047634(-) (degQ) [Bacillus subtilis strain RO-NN-1]
MEKKLEEVKQLLFRLELDIKETTDSLRNINKSIDQLDKYNYAMKIS

Nucleotide


Download         Length: 141 bp        

>NTDB_id=725041 NYR91_RS15755 WP_003220708.1 3047494..3047634(-) (degQ) [Bacillus subtilis strain RO-NN-1]
ATGGAAAAGAAACTTGAAGAAGTAAAACAATTGTTATTCCGACTCGAACTTGATATTAAAGAAACGACAGATTCATTACG
AAACATTAACAAAAGCATTGATCAACTCGATAAATACAATTATGCAATGAAAATTTCGTGA

Domains

Predicted by InterproScan.

DegQ (SacQ) family (DegQ)

(1-46)


Secondary structure

Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure

Source ID Structure
  AlphaFold DB G4P060

Transmembrane helices

Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.


Visualization of predicted probability:


Similar proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  degQ Bacillus subtilis subsp. subtilis str. 168

100

100

1