Detailed information    

insolico Bioinformatically predicted

Overview


Name   degQ   Type   Regulator
Locus tag   NYR92_RS17225 Genome accession   NZ_CP103783
Coordinates   3256346..3256486 (-) Length   46 a.a.
NCBI ID   WP_003220708.1    Uniprot ID   G4P060
Organism   Bacillus subtilis subsp. subtilis str. 168     
Function   modification of regulators (predicted from homology)   
Competence regulation

Genomic Context


Location: 3251346..3261486
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  NYR92_RS17200 (NYR92_17200) yuxO 3251659..3252039 (-) 381 WP_003228810.1 hotdog fold thioesterase -
  NYR92_RS17205 (NYR92_17205) comA 3252058..3252702 (-) 645 WP_003220716.1 two-component system response regulator ComA Regulator
  NYR92_RS17210 (NYR92_17210) comP 3252783..3255092 (-) 2310 WP_003242894.1 two-component system sensor histidine kinase ComP Regulator
  NYR92_RS17215 (NYR92_17215) comX 3255107..3255274 (-) 168 WP_003242801.1 competence pheromone ComX Regulator
  NYR92_RS17220 (NYR92_17220) comQ 3255262..3256161 (-) 900 WP_003243039.1 ComX modifying isoprenyl transferase ComQ Regulator
  NYR92_RS17225 (NYR92_17225) degQ 3256346..3256486 (-) 141 WP_003220708.1 degradation enzyme regulation protein DegQ Regulator
  NYR92_RS17230 (NYR92_17230) - 3256708..3256833 (+) 126 WP_003228793.1 hypothetical protein -
  NYR92_RS17235 (NYR92_17235) - 3256947..3257315 (+) 369 WP_003243784.1 hypothetical protein -
  NYR92_RS17240 (NYR92_17240) pdeH 3257291..3258520 (-) 1230 WP_003243525.1 cyclic di-GMP phosphodiesterase -
  NYR92_RS17245 (NYR92_17245) pncB 3258657..3260129 (-) 1473 WP_003228788.1 nicotinate phosphoribosyltransferase -
  NYR92_RS17250 (NYR92_17250) pncA 3260145..3260696 (-) 552 WP_003243099.1 cysteine hydrolase family protein -
  NYR92_RS17255 (NYR92_17255) yueI 3260793..3261191 (-) 399 WP_003242987.1 YueI family protein -

Sequence


Protein


Download         Length: 46 a.a.        Molecular weight: 5546.44 Da        Isoelectric Point: 6.2559

>NTDB_id=724962 NYR92_RS17225 WP_003220708.1 3256346..3256486(-) (degQ) [Bacillus subtilis subsp. subtilis str. 168]
MEKKLEEVKQLLFRLELDIKETTDSLRNINKSIDQLDKYNYAMKIS

Nucleotide


Download         Length: 141 bp        

>NTDB_id=724962 NYR92_RS17225 WP_003220708.1 3256346..3256486(-) (degQ) [Bacillus subtilis subsp. subtilis str. 168]
ATGGAAAAGAAACTTGAAGAAGTAAAACAATTGTTATTCCGACTCGAACTTGATATTAAAGAAACGACAGATTCATTACG
AAACATTAACAAAAGCATTGATCAACTCGATAAATACAATTATGCAATGAAAATTTCGTGA

Domains


Predicted by InterProScan.

(1-46)


Secondary structure


Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure


Source ID Structure

Transmembrane helices


Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.



Visualization of predicted probability:


Similar proteins


Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  degQ Bacillus subtilis subsp. subtilis str. 168

100

100

1