Detailed information
Overview
| Name | sinI | Type | Regulator |
| Locus tag | NYR92_RS13350 | Genome accession | NZ_CP103783 |
| Coordinates | 2551795..2551968 (+) | Length | 57 a.a. |
| NCBI ID | WP_003230187.1 | Uniprot ID | A0A063X7W9 |
| Organism | Bacillus subtilis subsp. subtilis str. 168 | ||
| Function | inhibit the expression of sinR (predicted from homology) Competence regulation |
||
Genomic Context
Location: 2546795..2556968
| Locus tag | Gene name | Coordinates (strand) | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| NYR92_RS13335 (NYR92_13335) | gcvT | 2547594..2548682 (-) | 1089 | WP_004398598.1 | glycine cleavage system aminomethyltransferase GcvT | - |
| NYR92_RS13340 (NYR92_13340) | hepAA | 2549124..2550797 (+) | 1674 | WP_004398544.1 | DEAD/DEAH box helicase | - |
| NYR92_RS13345 (NYR92_13345) | yqhG | 2550818..2551612 (+) | 795 | WP_003230200.1 | YqhG family protein | - |
| NYR92_RS13350 (NYR92_13350) | sinI | 2551795..2551968 (+) | 174 | WP_003230187.1 | anti-repressor SinI | Regulator |
| NYR92_RS13355 (NYR92_13355) | sinR | 2552002..2552337 (+) | 336 | WP_003226345.1 | transcriptional regulator SinR | Regulator |
| NYR92_RS13360 (NYR92_13360) | tasA | 2552430..2553215 (-) | 786 | WP_004398632.1 | biofilm matrix protein TasA | - |
| NYR92_RS13365 (NYR92_13365) | sipW | 2553279..2553851 (-) | 573 | WP_003246088.1 | signal peptidase I SipW | - |
| NYR92_RS13370 (NYR92_13370) | tapA | 2553835..2554596 (-) | 762 | WP_004399106.1 | amyloid fiber anchoring/assembly protein TapA | - |
| NYR92_RS13375 (NYR92_13375) | yqzG | 2554868..2555194 (+) | 327 | WP_003246051.1 | YqzG/YhdC family protein | - |
| NYR92_RS13380 (NYR92_13380) | spoIITA | 2555236..2555415 (-) | 180 | WP_003230176.1 | YqzE family protein | - |
| NYR92_RS13385 (NYR92_13385) | comGG | 2555486..2555860 (-) | 375 | WP_003230170.1 | ComG operon protein ComGG | Machinery gene |
| NYR92_RS13390 (NYR92_13390) | comGF | 2555861..2556244 (-) | 384 | WP_003230168.1 | ComG operon protein ComGF | Machinery gene |
| NYR92_RS13395 (NYR92_13395) | comGE | 2556270..2556617 (-) | 348 | WP_003230165.1 | ComG operon protein 5 | Machinery gene |
Sequence
Protein
Download Length: 57 a.a. Molecular weight: 6601.52 Da Isoelectric Point: 6.7231
>NTDB_id=724936 NYR92_RS13350 WP_003230187.1 2551795..2551968(+) (sinI) [Bacillus subtilis subsp. subtilis str. 168]
MKNAKQEHFELDQEWVELMVEAKEANISPEEIRKYLLLNKKSAHPGPAARSHTVNPF
MKNAKQEHFELDQEWVELMVEAKEANISPEEIRKYLLLNKKSAHPGPAARSHTVNPF
Nucleotide
Download Length: 174 bp
>NTDB_id=724936 NYR92_RS13350 WP_003230187.1 2551795..2551968(+) (sinI) [Bacillus subtilis subsp. subtilis str. 168]
ATGAAGAATGCAAAACAAGAGCACTTTGAATTGGATCAAGAATGGGTTGAATTAATGGTGGAAGCCAAAGAGGCAAATAT
CAGCCCGGAAGAAATACGAAAATATTTACTTTTAAACAAAAAGTCTGCTCATCCTGGTCCGGCAGCCAGAAGTCATACCG
TAAATCCTTTCTGA
ATGAAGAATGCAAAACAAGAGCACTTTGAATTGGATCAAGAATGGGTTGAATTAATGGTGGAAGCCAAAGAGGCAAATAT
CAGCCCGGAAGAAATACGAAAATATTTACTTTTAAACAAAAAGTCTGCTCATCCTGGTCCGGCAGCCAGAAGTCATACCG
TAAATCCTTTCTGA
Similar proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|---|---|---|---|
| sinI | Bacillus subtilis subsp. subtilis str. 168 |
100 |
100 |
1 |