Detailed information    

insolico Bioinformatically predicted

Overview

Name   sinI   Type   Regulator
Locus tag   NYR92_RS13350 Genome accession   NZ_CP103783
Coordinates   2551795..2551968 (+) Length   57 a.a.
NCBI ID   WP_003230187.1    Uniprot ID   A0A063X7W9
Organism   Bacillus subtilis subsp. subtilis str. 168     
Function   inhibit the expression of sinR (predicted from homology)   
Competence regulation

Genomic Context

Location: 2546795..2556968
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  NYR92_RS13335 (NYR92_13335) gcvT 2547594..2548682 (-) 1089 WP_004398598.1 glycine cleavage system aminomethyltransferase GcvT -
  NYR92_RS13340 (NYR92_13340) hepAA 2549124..2550797 (+) 1674 WP_004398544.1 DEAD/DEAH box helicase -
  NYR92_RS13345 (NYR92_13345) yqhG 2550818..2551612 (+) 795 WP_003230200.1 YqhG family protein -
  NYR92_RS13350 (NYR92_13350) sinI 2551795..2551968 (+) 174 WP_003230187.1 anti-repressor SinI Regulator
  NYR92_RS13355 (NYR92_13355) sinR 2552002..2552337 (+) 336 WP_003226345.1 transcriptional regulator SinR Regulator
  NYR92_RS13360 (NYR92_13360) tasA 2552430..2553215 (-) 786 WP_004398632.1 biofilm matrix protein TasA -
  NYR92_RS13365 (NYR92_13365) sipW 2553279..2553851 (-) 573 WP_003246088.1 signal peptidase I SipW -
  NYR92_RS13370 (NYR92_13370) tapA 2553835..2554596 (-) 762 WP_004399106.1 amyloid fiber anchoring/assembly protein TapA -
  NYR92_RS13375 (NYR92_13375) yqzG 2554868..2555194 (+) 327 WP_003246051.1 YqzG/YhdC family protein -
  NYR92_RS13380 (NYR92_13380) spoIITA 2555236..2555415 (-) 180 WP_003230176.1 YqzE family protein -
  NYR92_RS13385 (NYR92_13385) comGG 2555486..2555860 (-) 375 WP_003230170.1 ComG operon protein ComGG Machinery gene
  NYR92_RS13390 (NYR92_13390) comGF 2555861..2556244 (-) 384 WP_003230168.1 ComG operon protein ComGF Machinery gene
  NYR92_RS13395 (NYR92_13395) comGE 2556270..2556617 (-) 348 WP_003230165.1 ComG operon protein 5 Machinery gene

Sequence

Protein


Download         Length: 57 a.a.        Molecular weight: 6601.52 Da        Isoelectric Point: 6.7231

>NTDB_id=724936 NYR92_RS13350 WP_003230187.1 2551795..2551968(+) (sinI) [Bacillus subtilis subsp. subtilis str. 168]
MKNAKQEHFELDQEWVELMVEAKEANISPEEIRKYLLLNKKSAHPGPAARSHTVNPF

Nucleotide


Download         Length: 174 bp        

>NTDB_id=724936 NYR92_RS13350 WP_003230187.1 2551795..2551968(+) (sinI) [Bacillus subtilis subsp. subtilis str. 168]
ATGAAGAATGCAAAACAAGAGCACTTTGAATTGGATCAAGAATGGGTTGAATTAATGGTGGAAGCCAAAGAGGCAAATAT
CAGCCCGGAAGAAATACGAAAATATTTACTTTTAAACAAAAAGTCTGCTCATCCTGGTCCGGCAGCCAGAAGTCATACCG
TAAATCCTTTCTGA

Domains

Predicted by InterproScan.

Anti-repressor SinI (SinI)

(11-36)


Secondary structure

Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure

Source ID Structure
  AlphaFold DB A0A063X7W9

Transmembrane helices

Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.


Visualization of predicted probability:


Similar proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  sinI Bacillus subtilis subsp. subtilis str. 168

100

100

1