Detailed information NTG0722333

Bioinformatically predicted

Overview

• Name: phrF
• Type: Regulator
• Locus tag: NX823_RS19840
• Genome accession: NZ_CP103352
• Coordinates: 3721849..3721968 (+)
• Length: 39 a.a.
• NCBI ID: WP_009968329.1
• Uniprot ID: A0A199WEM2
• Organism: Bacillus subtilis strain SRCM117508
• Function: antagonize RapF (predicted from homology) Competence regulation

Related MGE

Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.

Gene-MGE association summary

MGE type	MGE coordinates	Gene coordinates	Relative position	Distance (bp)
IS/Tn	3722087..3723439	3721849..3721968	flank	119

Gene organization within MGE regions

Location: 3721849..3723439

Locus tag	Gene name	Coordinates (strand)	Size (bp)	Protein ID	Product	Description
NX823_RS19840 (NX823_19840)	phrF	3721849..3721968 (+)	120	WP_009968329.1	phosphatase RapF inhibitor PhrF	Regulator
NX823_RS19845 (NX823_19845)	-	3722087..3723439 (+)	1353	WP_014478984.1	IS1182 family transposase	-

Sequence

Protein

• Length: 39 a.a.
• Molecular weight: 4199.10 Da
• Isoelectric Point: 10.4997

>NTDB_id=722333 NX823_RS19840 WP_009968329.1 3721849..3721968(+) (phrF) [Bacillus subtilis strain SRCM117508]
MKLKSKLLLSCLALSTVFVATTIANAPTHQIEVAQRGMI

Nucleotide

• Length: 120 bp

>NTDB_id=722333 NX823_RS19840 WP_009968329.1 3721849..3721968(+) (phrF) [Bacillus subtilis strain SRCM117508]
ATGAAATTGAAGTCTAAACTATTACTCTCTTGTCTGGCTCTAAGCACTGTGTTCGTGGCAACAACTATTGCAAATGCACC
TACACACCAAATTGAAGTTGCACAACGAGGAATGATTTAA

Domains

Predicted by InterproScan.

• Rap-phr extracellular signalling (PhrC_PhrF) (3-39)

3D structure

• AlphaFold DB: A0A199WEM2

Similar proteins

Only experimentally validated proteins are listed.

Protein	Organism	Identities (%)	Coverage (%)	Ha-value
phrF	Bacillus subtilis subsp. subtilis str. 168	100	100	1
phrC	Bacillus subtilis subsp. subtilis str. 168	48.718	100	0.487