Detailed information    

insolico Bioinformatically predicted

Overview


Name   sinI   Type   Regulator
Locus tag   NX819_RS12615 Genome accession   NZ_CP103351
Coordinates   2467785..2467958 (+) Length   57 a.a.
NCBI ID   WP_259266248.1    Uniprot ID   -
Organism   Bacillus subtilis strain SRCM115947     
Function   inhibit the expression of sinR (predicted from homology)   
Competence regulation

Genomic Context


Location: 2462785..2472958
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  NX819_RS12600 (NX819_12600) gcvT 2463585..2464673 (-) 1089 WP_015714248.1 glycine cleavage system aminomethyltransferase GcvT -
  NX819_RS12605 (NX819_12605) hepAA 2465114..2466787 (+) 1674 WP_029726726.1 DEAD/DEAH box helicase -
  NX819_RS12610 (NX819_12610) yqhG 2466808..2467602 (+) 795 WP_015714249.1 YqhG family protein -
  NX819_RS12615 (NX819_12615) sinI 2467785..2467958 (+) 174 WP_259266248.1 anti-repressor SinI Regulator
  NX819_RS12620 (NX819_12620) sinR 2467992..2468327 (+) 336 WP_003226345.1 transcriptional regulator SinR Regulator
  NX819_RS12625 (NX819_12625) tasA 2468420..2469205 (-) 786 WP_014664586.1 biofilm matrix protein TasA -
  NX819_RS12630 (NX819_12630) sipW 2469269..2469841 (-) 573 WP_072692741.1 signal peptidase I SipW -
  NX819_RS12635 (NX819_12635) tapA 2469825..2470586 (-) 762 WP_029726724.1 amyloid fiber anchoring/assembly protein TapA -
  NX819_RS12640 (NX819_12640) yqzG 2470858..2471184 (+) 327 WP_003246051.1 YqzG/YhdC family protein -
  NX819_RS12645 (NX819_12645) spoIITA 2471226..2471405 (-) 180 WP_029726723.1 YqzE family protein -
  NX819_RS12650 (NX819_12650) comGG 2471477..2471851 (-) 375 WP_029726722.1 ComG operon protein ComGG Machinery gene
  NX819_RS12655 (NX819_12655) comGF 2471852..2472235 (-) 384 WP_029726721.1 ComG operon protein ComGF Machinery gene
  NX819_RS12660 (NX819_12660) comGE 2472261..2472608 (-) 348 WP_014480255.1 ComG operon protein 5 Machinery gene

Sequence


Protein


Download         Length: 57 a.a.        Molecular weight: 6632.53 Da        Isoelectric Point: 6.7231

>NTDB_id=722218 NX819_RS12615 WP_259266248.1 2467785..2467958(+) (sinI) [Bacillus subtilis strain SRCM115947]
MKNAKQEHFELDQEWVELMVEAKEANISQEEIRKYLLLNKKSAHPGPAARSHTVNPF

Nucleotide


Download         Length: 174 bp        

>NTDB_id=722218 NX819_RS12615 WP_259266248.1 2467785..2467958(+) (sinI) [Bacillus subtilis strain SRCM115947]
ATGAAGAATGCAAAACAAGAGCACTTTGAATTGGATCAAGAATGGGTTGAATTAATGGTGGAAGCCAAAGAGGCAAATAT
CAGCCAGGAAGAAATACGAAAATATTTACTTTTAAACAAAAAGTCTGCTCATCCTGGTCCGGCAGCCAGAAGTCATACCG
TAAATCCTTTCTGA

Domains


Predicted by InterproScan.

(11-36)


Secondary structure


Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure


Source ID Structure

Transmembrane helices


Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.



Visualization of predicted probability:


Similar proteins


Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  sinI Bacillus subtilis subsp. subtilis str. 168

98.246

100

0.982