Detailed information    

insolico Bioinformatically predicted

Overview


Name   comGF   Type   Machinery gene
Locus tag   NX819_RS12655 Genome accession   NZ_CP103351
Coordinates   2471852..2472235 (-) Length   127 a.a.
NCBI ID   WP_029726721.1    Uniprot ID   -
Organism   Bacillus subtilis strain SRCM115947     
Function   dsDNA binding to the cell surface; assembly of the pseudopilus (predicted from homology)   
DNA binding and uptake

Genomic Context


Location: 2466852..2477235
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  NX819_RS12615 (NX819_12615) sinI 2467785..2467958 (+) 174 WP_259266248.1 anti-repressor SinI Regulator
  NX819_RS12620 (NX819_12620) sinR 2467992..2468327 (+) 336 WP_003226345.1 transcriptional regulator SinR Regulator
  NX819_RS12625 (NX819_12625) tasA 2468420..2469205 (-) 786 WP_014664586.1 biofilm matrix protein TasA -
  NX819_RS12630 (NX819_12630) sipW 2469269..2469841 (-) 573 WP_072692741.1 signal peptidase I SipW -
  NX819_RS12635 (NX819_12635) tapA 2469825..2470586 (-) 762 WP_029726724.1 amyloid fiber anchoring/assembly protein TapA -
  NX819_RS12640 (NX819_12640) yqzG 2470858..2471184 (+) 327 WP_003246051.1 YqzG/YhdC family protein -
  NX819_RS12645 (NX819_12645) spoIITA 2471226..2471405 (-) 180 WP_029726723.1 YqzE family protein -
  NX819_RS12650 (NX819_12650) comGG 2471477..2471851 (-) 375 WP_029726722.1 ComG operon protein ComGG Machinery gene
  NX819_RS12655 (NX819_12655) comGF 2471852..2472235 (-) 384 WP_029726721.1 ComG operon protein ComGF Machinery gene
  NX819_RS12660 (NX819_12660) comGE 2472261..2472608 (-) 348 WP_014480255.1 ComG operon protein 5 Machinery gene
  NX819_RS12665 (NX819_12665) comGD 2472592..2473023 (-) 432 WP_029726720.1 comG operon protein ComGD Machinery gene
  NX819_RS12670 (NX819_12670) comGC 2473013..2473309 (-) 297 WP_029726719.1 comG operon protein ComGC Machinery gene
  NX819_RS12675 (NX819_12675) comGB 2473323..2474360 (-) 1038 WP_029726718.1 comG operon protein ComGB Machinery gene
  NX819_RS12680 (NX819_12680) comGA 2474347..2475417 (-) 1071 WP_004399124.1 competence protein ComGA Machinery gene
  NX819_RS12685 (NX819_12685) - 2475630..2475827 (-) 198 WP_029726717.1 hypothetical protein -
  NX819_RS12690 (NX819_12690) corA 2475829..2476782 (-) 954 WP_004399136.1 magnesium transporter CorA -

Sequence


Protein


Download         Length: 127 a.a.        Molecular weight: 14409.52 Da        Isoelectric Point: 5.8940

>NTDB_id=722221 NX819_RS12655 WP_029726721.1 2471852..2472235(-) (comGF) [Bacillus subtilis strain SRCM115947]
MLISGSLAAIFHLFLSRQQEHDGFTQQEWMISIEQMMNECKESQAVKTAEHGSVLICTNLSGQDIRFEIYHSMIRKRVDG
KGHVPILDHITAMKADFENCVVLLKIESEDQKVYQTAFPVYSYLGGG

Nucleotide


Download         Length: 384 bp        

>NTDB_id=722221 NX819_RS12655 WP_029726721.1 2471852..2472235(-) (comGF) [Bacillus subtilis strain SRCM115947]
TTGCTCATATCAGGATCGTTAGCTGCGATTTTCCATCTGTTTTTGTCTCGACAGCAGGAACATGACGGTTTCACACAGCA
AGAATGGATGATTTCGATAGAACAGATGATGAATGAATGCAAGGAGTCACAGGCAGTTAAGACAGCCGAGCATGGGAGCG
TGTTAATCTGCACCAATCTTTCCGGGCAGGACATCCGTTTCGAAATTTATCATTCAATGATAAGAAAAAGAGTGGATGGT
AAAGGGCATGTTCCGATTTTAGATCATATTACTGCCATGAAAGCTGATTTTGAAAATTGTGTTGTTTTGCTGAAAATTGA
GAGTGAGGACCAAAAAGTGTATCAAACTGCTTTTCCAGTCTATTCGTATTTAGGAGGGGGGTGA


Secondary structure


Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure


Source ID Structure

Transmembrane helices


Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.



Visualization of predicted probability:


Similar proteins


Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  comGF Bacillus subtilis subsp. subtilis str. 168

96.85

100

0.969