Detailed information    

insolico Bioinformatically predicted

Overview


Name   comGF   Type   Machinery gene
Locus tag   NX810_RS13150 Genome accession   NZ_CP103350
Coordinates   2521201..2521584 (-) Length   127 a.a.
NCBI ID   WP_029726721.1    Uniprot ID   -
Organism   Bacillus subtilis strain SRCM117108     
Function   dsDNA binding to the cell surface; assembly of the pseudopilus (predicted from homology)   
DNA binding and uptake

Genomic Context


Location: 2516201..2526584
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  NX810_RS13110 (NX810_13110) sinI 2517134..2517307 (+) 174 WP_003230187.1 anti-repressor SinI Regulator
  NX810_RS13115 (NX810_13115) sinR 2517341..2517676 (+) 336 WP_003226345.1 transcriptional regulator SinR Regulator
  NX810_RS13120 (NX810_13120) tasA 2517769..2518554 (-) 786 WP_003230183.1 biofilm matrix protein TasA -
  NX810_RS13125 (NX810_13125) sipW 2518618..2519190 (-) 573 WP_003230181.1 signal peptidase I SipW -
  NX810_RS13130 (NX810_13130) tapA 2519174..2519935 (-) 762 WP_003230180.1 amyloid fiber anchoring/assembly protein TapA -
  NX810_RS13135 (NX810_13135) yqzG 2520207..2520533 (+) 327 WP_003246051.1 YqzG/YhdC family protein -
  NX810_RS13140 (NX810_13140) spoIITA 2520575..2520754 (-) 180 WP_029726723.1 YqzE family protein -
  NX810_RS13145 (NX810_13145) comGG 2520826..2521200 (-) 375 WP_029726722.1 ComG operon protein ComGG Machinery gene
  NX810_RS13150 (NX810_13150) comGF 2521201..2521584 (-) 384 WP_029726721.1 ComG operon protein ComGF Machinery gene
  NX810_RS13155 (NX810_13155) comGE 2521610..2521957 (-) 348 WP_014480255.1 ComG operon protein 5 Machinery gene
  NX810_RS13160 (NX810_13160) comGD 2521941..2522372 (-) 432 WP_029726720.1 comG operon protein ComGD Machinery gene
  NX810_RS13165 (NX810_13165) comGC 2522362..2522658 (-) 297 WP_029726719.1 comG operon protein ComGC Machinery gene
  NX810_RS13170 (NX810_13170) comGB 2522672..2523709 (-) 1038 WP_029726718.1 comG operon protein ComGB Machinery gene
  NX810_RS13175 (NX810_13175) comGA 2523696..2524766 (-) 1071 WP_004399124.1 competence protein ComGA Machinery gene
  NX810_RS13180 (NX810_13180) - 2524979..2525176 (-) 198 WP_029726717.1 hypothetical protein -
  NX810_RS13185 (NX810_13185) corA 2525178..2526131 (-) 954 WP_004399136.1 magnesium transporter CorA -

Sequence


Protein


Download         Length: 127 a.a.        Molecular weight: 14409.52 Da        Isoelectric Point: 5.8940

>NTDB_id=722142 NX810_RS13150 WP_029726721.1 2521201..2521584(-) (comGF) [Bacillus subtilis strain SRCM117108]
MLISGSLAAIFHLFLSRQQEHDGFTQQEWMISIEQMMNECKESQAVKTAEHGSVLICTNLSGQDIRFEIYHSMIRKRVDG
KGHVPILDHITAMKADFENCVVLLKIESEDQKVYQTAFPVYSYLGGG

Nucleotide


Download         Length: 384 bp        

>NTDB_id=722142 NX810_RS13150 WP_029726721.1 2521201..2521584(-) (comGF) [Bacillus subtilis strain SRCM117108]
TTGCTCATATCAGGATCGTTAGCTGCGATTTTCCATCTGTTTTTGTCTCGACAGCAGGAACATGACGGTTTCACACAGCA
AGAATGGATGATTTCGATAGAACAGATGATGAATGAATGCAAGGAGTCACAGGCAGTTAAGACAGCCGAGCATGGGAGCG
TGTTAATCTGCACCAATCTTTCCGGGCAGGACATCCGTTTCGAAATTTATCATTCAATGATAAGAAAAAGAGTGGATGGT
AAAGGGCATGTTCCGATTTTAGATCATATTACTGCCATGAAAGCTGATTTTGAAAATTGTGTTGTTTTGCTGAAAATTGA
GAGTGAGGACCAAAAAGTGTATCAAACTGCTTTTCCAGTCTATTCGTATTTAGGAGGGGGGTGA


Secondary structure


Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure


Source ID Structure

Transmembrane helices


Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.



Visualization of predicted probability:


Similar proteins


Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  comGF Bacillus subtilis subsp. subtilis str. 168

96.85

100

0.969