Detailed information    

insolico Bioinformatically predicted

Overview

Name   sinI   Type   Regulator
Locus tag   NX810_RS13110 Genome accession   NZ_CP103350
Coordinates   2517134..2517307 (+) Length   57 a.a.
NCBI ID   WP_003230187.1    Uniprot ID   A0A063X7W9
Organism   Bacillus subtilis strain SRCM117108     
Function   inhibit the expression of sinR (predicted from homology)   
Competence regulation

Genomic Context

Location: 2512134..2522307
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  NX810_RS13095 (NX810_13095) gcvT 2512933..2514021 (-) 1089 WP_003230205.1 glycine cleavage system aminomethyltransferase GcvT -
  NX810_RS13100 (NX810_13100) hepAA 2514463..2516136 (+) 1674 WP_003230203.1 DEAD/DEAH box helicase -
  NX810_RS13105 (NX810_13105) yqhG 2516157..2516951 (+) 795 WP_003230200.1 YqhG family protein -
  NX810_RS13110 (NX810_13110) sinI 2517134..2517307 (+) 174 WP_003230187.1 anti-repressor SinI Regulator
  NX810_RS13115 (NX810_13115) sinR 2517341..2517676 (+) 336 WP_003226345.1 transcriptional regulator SinR Regulator
  NX810_RS13120 (NX810_13120) tasA 2517769..2518554 (-) 786 WP_003230183.1 biofilm matrix protein TasA -
  NX810_RS13125 (NX810_13125) sipW 2518618..2519190 (-) 573 WP_003230181.1 signal peptidase I SipW -
  NX810_RS13130 (NX810_13130) tapA 2519174..2519935 (-) 762 WP_003230180.1 amyloid fiber anchoring/assembly protein TapA -
  NX810_RS13135 (NX810_13135) yqzG 2520207..2520533 (+) 327 WP_003246051.1 YqzG/YhdC family protein -
  NX810_RS13140 (NX810_13140) spoIITA 2520575..2520754 (-) 180 WP_029726723.1 YqzE family protein -
  NX810_RS13145 (NX810_13145) comGG 2520826..2521200 (-) 375 WP_029726722.1 ComG operon protein ComGG Machinery gene
  NX810_RS13150 (NX810_13150) comGF 2521201..2521584 (-) 384 WP_029726721.1 ComG operon protein ComGF Machinery gene
  NX810_RS13155 (NX810_13155) comGE 2521610..2521957 (-) 348 WP_014480255.1 ComG operon protein 5 Machinery gene

Sequence

Protein


Download         Length: 57 a.a.        Molecular weight: 6601.52 Da        Isoelectric Point: 6.7231

>NTDB_id=722139 NX810_RS13110 WP_003230187.1 2517134..2517307(+) (sinI) [Bacillus subtilis strain SRCM117108]
MKNAKQEHFELDQEWVELMVEAKEANISPEEIRKYLLLNKKSAHPGPAARSHTVNPF

Nucleotide


Download         Length: 174 bp        

>NTDB_id=722139 NX810_RS13110 WP_003230187.1 2517134..2517307(+) (sinI) [Bacillus subtilis strain SRCM117108]
ATGAAGAATGCAAAACAAGAGCACTTTGAATTGGATCAAGAATGGGTTGAATTAATGGTGGAAGCCAAAGAGGCAAATAT
CAGCCCGGAAGAAATACGAAAATATTTACTTTTAAACAAAAAGTCTGCTCATCCTGGTCCGGCAGCCAGAAGTCATACCG
TAAATCCTTTCTGA

Domains

Predicted by InterproScan.

Anti-repressor SinI (SinI)

(11-36)


Secondary structure

Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure

Source ID Structure
  AlphaFold DB A0A063X7W9

Transmembrane helices

Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.


Visualization of predicted probability:


Similar proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  sinI Bacillus subtilis subsp. subtilis str. 168

100

100

1