Detailed information    

insolico Bioinformatically predicted

Overview

Name   degQ   Type   Regulator
Locus tag   NX062_RS15850 Genome accession   NZ_CP103328
Coordinates   2963263..2963403 (-) Length   46 a.a.
NCBI ID   WP_003220708.1    Uniprot ID   G4P060
Organism   Bacillus subtilis strain KC14-1     
Function   modification of regulators (predicted from homology)   
Competence regulation

Genomic Context

Location: 2958263..2968403
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  NX062_RS15825 (NX062_15835) yuxO 2958605..2958985 (-) 381 WP_014477831.1 hotdog fold thioesterase -
  NX062_RS15830 (NX062_15840) comA 2959004..2959648 (-) 645 WP_003220716.1 two-component system response regulator ComA Regulator
  NX062_RS15835 (NX062_15845) - 2959729..2962034 (-) 2306 Protein_3053 histidine kinase -
  NX062_RS15840 (NX062_15850) comX 2962042..2962203 (-) 162 WP_003241045.1 competence pheromone ComX -
  NX062_RS15845 (NX062_15855) - 2962218..2963078 (-) 861 WP_046160795.1 polyprenyl synthetase family protein -
  NX062_RS15850 (NX062_15860) degQ 2963263..2963403 (-) 141 WP_003220708.1 degradation enzyme regulation protein DegQ Regulator
  NX062_RS15855 (NX062_15865) - 2963625..2963750 (+) 126 WP_120028613.1 hypothetical protein -
  NX062_RS15860 (NX062_15870) - 2963865..2964233 (+) 369 WP_017695529.1 hypothetical protein -
  NX062_RS15865 (NX062_15875) pdeH 2964209..2965438 (-) 1230 WP_003243525.1 cyclic di-GMP phosphodiesterase -
  NX062_RS15870 (NX062_15880) pncB 2965575..2967047 (-) 1473 WP_129110551.1 nicotinate phosphoribosyltransferase -
  NX062_RS15875 (NX062_15885) pncA 2967063..2967614 (-) 552 WP_262091009.1 cysteine hydrolase family protein -
  NX062_RS15880 (NX062_15890) yueI 2967711..2968109 (-) 399 WP_015251331.1 YueI family protein -

Sequence

Protein


Download         Length: 46 a.a.        Molecular weight: 5546.44 Da        Isoelectric Point: 6.2559

>NTDB_id=722005 NX062_RS15850 WP_003220708.1 2963263..2963403(-) (degQ) [Bacillus subtilis strain KC14-1]
MEKKLEEVKQLLFRLELDIKETTDSLRNINKSIDQLDKYNYAMKIS

Nucleotide


Download         Length: 141 bp        

>NTDB_id=722005 NX062_RS15850 WP_003220708.1 2963263..2963403(-) (degQ) [Bacillus subtilis strain KC14-1]
ATGGAAAAGAAACTTGAAGAAGTAAAACAATTGTTATTCCGACTCGAACTTGATATTAAAGAAACGACAGATTCATTACG
AAACATTAACAAAAGCATTGATCAACTCGATAAATACAATTATGCAATGAAAATTTCGTGA

Domains

Predicted by InterproScan.

DegQ (SacQ) family (DegQ)

(1-46)


Secondary structure

Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure

Source ID Structure
  AlphaFold DB G4P060

Transmembrane helices

Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.


Visualization of predicted probability:


Similar proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  degQ Bacillus subtilis subsp. subtilis str. 168

100

100

1