Detailed information
Overview
| Name | degQ | Type | Regulator |
| Locus tag | NXY85_RS11620 | Genome accession | NZ_CP103290 |
| Coordinates | 2252076..2252219 (-) | Length | 47 a.a. |
| NCBI ID | WP_003327149.1 | Uniprot ID | - |
| Organism | Bacillus atrophaeus strain NS2 | ||
| Function | modification of regulators (predicted from homology) Competence regulation |
||
Genomic Context
Location: 2247076..2257219
| Locus tag | Gene name | Coordinates (strand) | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| NXY85_RS11595 | - | 2247427..2247807 (-) | 381 | WP_199679676.1 | hotdog fold thioesterase | - |
| NXY85_RS11600 | comA | 2247825..2248466 (-) | 642 | WP_003327154.1 | response regulator transcription factor | Regulator |
| NXY85_RS11605 | - | 2248547..2250844 (-) | 2298 | Protein_2292 | histidine kinase | - |
| NXY85_RS11610 | comX | 2250855..2251019 (-) | 165 | WP_106046982.1 | competence pheromone ComX | - |
| NXY85_RS11615 | - | 2251032..2251892 (-) | 861 | WP_216412504.1 | polyprenyl synthetase family protein | - |
| NXY85_RS11620 | degQ | 2252076..2252219 (-) | 144 | WP_003327149.1 | degradation enzyme regulation protein DegQ | Regulator |
| NXY85_RS11625 | - | 2252679..2253038 (+) | 360 | WP_063637895.1 | hypothetical protein | - |
| NXY85_RS11630 | - | 2253057..2254289 (-) | 1233 | WP_003327147.1 | EAL and HDOD domain-containing protein | - |
| NXY85_RS11635 | - | 2254427..2255893 (-) | 1467 | WP_088117879.1 | nicotinate phosphoribosyltransferase | - |
| NXY85_RS11640 | - | 2255909..2256460 (-) | 552 | WP_003327145.1 | cysteine hydrolase family protein | - |
| NXY85_RS11645 | - | 2256568..2256966 (-) | 399 | WP_003327144.1 | YueI family protein | - |
Sequence
Protein
Download Length: 47 a.a. Molecular weight: 5645.61 Da Isoelectric Point: 8.5787
>NTDB_id=721677 NXY85_RS11620 WP_003327149.1 2252076..2252219(-) (degQ) [Bacillus atrophaeus strain NS2]
MEKKKLEEVKQLLFRLELDIKETTDSLRNINKSIDQLDKFTYAMKIS
MEKKKLEEVKQLLFRLELDIKETTDSLRNINKSIDQLDKFTYAMKIS
Nucleotide
Download Length: 144 bp
>NTDB_id=721677 NXY85_RS11620 WP_003327149.1 2252076..2252219(-) (degQ) [Bacillus atrophaeus strain NS2]
GTGGAAAAGAAAAAACTTGAAGAAGTGAAACAATTATTATTCCGACTCGAACTTGATATCAAAGAAACGACAGATTCATT
ACGAAACATTAACAAAAGCATTGATCAGCTCGATAAATTCACATATGCAATGAAAATTTCGTGA
GTGGAAAAGAAAAAACTTGAAGAAGTGAAACAATTATTATTCCGACTCGAACTTGATATCAAAGAAACGACAGATTCATT
ACGAAACATTAACAAAAGCATTGATCAGCTCGATAAATTCACATATGCAATGAAAATTTCGTGA
3D structure
| Source | ID | Structure |
|---|
Similar proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|---|---|---|---|
| degQ | Bacillus subtilis subsp. subtilis str. 168 |
95.455 |
93.617 |
0.894 |