Detailed information    

insolico Bioinformatically predicted

Overview

Name   comGE   Type   Machinery gene
Locus tag   NXY85_RS07425 Genome accession   NZ_CP103290
Coordinates   1494550..1494897 (-) Length   115 a.a.
NCBI ID   WP_258729499.1    Uniprot ID   -
Organism   Bacillus atrophaeus strain NS2     
Function   dsDNA binding to the cell surface; assembly of the pseudopilus (predicted from homology)   
DNA binding and uptake

Genomic Context

Location: 1489550..1499897
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  NXY85_RS07380 sinI 1490049..1490222 (+) 174 WP_003325442.1 anti-repressor SinI Regulator
  NXY85_RS07385 sinR 1490256..1490591 (+) 336 WP_003153104.1 transcriptional regulator SinR Regulator
  NXY85_RS07390 tasA 1490782..1491564 (-) 783 WP_063638541.1 biofilm matrix protein TasA -
  NXY85_RS07395 sipW 1491628..1492200 (-) 573 WP_010789195.1 signal peptidase I SipW -
  NXY85_RS07400 tapA 1492184..1492885 (-) 702 WP_258729496.1 amyloid fiber anchoring/assembly protein TapA -
  NXY85_RS07405 - 1493147..1493470 (+) 324 WP_258729497.1 YqzG/YhdC family protein -
  NXY85_RS07410 - 1493517..1493696 (-) 180 WP_003325435.1 YqzE family protein -
  NXY85_RS07415 comGG 1493766..1494140 (-) 375 WP_258729498.1 competence type IV pilus minor pilin ComGG Machinery gene
  NXY85_RS07420 comGF 1494141..1494536 (-) 396 WP_309484978.1 competence type IV pilus minor pilin ComGF Machinery gene
  NXY85_RS07425 comGE 1494550..1494897 (-) 348 WP_258729499.1 competence type IV pilus minor pilin ComGE Machinery gene
  NXY85_RS07430 comGD 1494881..1495321 (-) 441 WP_106046743.1 competence type IV pilus minor pilin ComGD Machinery gene
  NXY85_RS07435 comGC 1495311..1495577 (-) 267 WP_047937532.1 competence type IV pilus major pilin ComGC Machinery gene
  NXY85_RS07440 comGB 1495625..1496662 (-) 1038 WP_258729500.1 competence type IV pilus assembly protein ComGB Machinery gene
  NXY85_RS07445 comGA 1496649..1497719 (-) 1071 WP_258729501.1 competence type IV pilus ATPase ComGA Machinery gene
  NXY85_RS07450 - 1498102..1499055 (-) 954 WP_258729502.1 magnesium transporter CorA family protein -

Sequence

Protein


Download         Length: 115 a.a.        Molecular weight: 13305.20 Da        Isoelectric Point: 4.4399

>NTDB_id=721658 NXY85_RS07425 WP_258729499.1 1494550..1494897(-) (comGE) [Bacillus atrophaeus strain NS2]
MWKENKGFSTIETVSALSTWVLITVMILPMWARLISDEKETAIQETGYQLLHESISTYMLSGEYGKSETIKRLNQTYKVT
WEEDGDNQKVCMEAVSPKDEPFCLSILRTDWLYPS

Nucleotide


Download         Length: 348 bp        

>NTDB_id=721658 NXY85_RS07425 WP_258729499.1 1494550..1494897(-) (comGE) [Bacillus atrophaeus strain NS2]
ATGTGGAAAGAAAATAAAGGCTTCTCAACAATTGAAACAGTCTCGGCTTTAAGCACTTGGGTATTGATTACAGTGATGAT
TCTCCCTATGTGGGCCAGACTGATATCAGATGAAAAAGAGACAGCCATTCAGGAAACCGGTTATCAGCTTCTTCACGAAA
GCATCAGTACATACATGCTTTCTGGAGAGTATGGAAAATCAGAGACAATAAAAAGGCTGAACCAAACCTATAAGGTCACG
TGGGAGGAGGATGGCGACAATCAAAAAGTATGTATGGAAGCGGTCAGCCCGAAGGACGAGCCCTTTTGTCTCAGCATTCT
TCGGACAGACTGGTTATACCCTTCTTAA

Domains


No domain identified.



Secondary structure

Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure

Source ID Structure

Transmembrane helices

Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.


Visualization of predicted probability:


Similar proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  comGE Bacillus subtilis subsp. subtilis str. 168

51.304

100

0.513