Detailed information    

insolico Bioinformatically predicted

Overview

Name   sinI   Type   Regulator
Locus tag   NXY85_RS07380 Genome accession   NZ_CP103290
Coordinates   1490049..1490222 (+) Length   57 a.a.
NCBI ID   WP_003325442.1    Uniprot ID   -
Organism   Bacillus atrophaeus strain NS2     
Function   inhibit the expression of sinR (predicted from homology)   
Competence regulation

Genomic Context

Location: 1485049..1495222
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  NXY85_RS07365 gcvT 1485819..1486913 (-) 1095 WP_106360542.1 glycine cleavage system aminomethyltransferase GcvT -
  NXY85_RS07370 - 1487374..1489044 (+) 1671 WP_258729494.1 DEAD/DEAH box helicase -
  NXY85_RS07375 - 1489065..1489859 (+) 795 WP_258729495.1 YqhG family protein -
  NXY85_RS07380 sinI 1490049..1490222 (+) 174 WP_003325442.1 anti-repressor SinI Regulator
  NXY85_RS07385 sinR 1490256..1490591 (+) 336 WP_003153104.1 transcriptional regulator SinR Regulator
  NXY85_RS07390 tasA 1490782..1491564 (-) 783 WP_063638541.1 biofilm matrix protein TasA -
  NXY85_RS07395 sipW 1491628..1492200 (-) 573 WP_010789195.1 signal peptidase I SipW -
  NXY85_RS07400 tapA 1492184..1492885 (-) 702 WP_258729496.1 amyloid fiber anchoring/assembly protein TapA -
  NXY85_RS07405 - 1493147..1493470 (+) 324 WP_258729497.1 YqzG/YhdC family protein -
  NXY85_RS07410 - 1493517..1493696 (-) 180 WP_003325435.1 YqzE family protein -
  NXY85_RS07415 comGG 1493766..1494140 (-) 375 WP_258729498.1 competence type IV pilus minor pilin ComGG Machinery gene
  NXY85_RS07420 comGF 1494141..1494536 (-) 396 WP_309484978.1 competence type IV pilus minor pilin ComGF Machinery gene
  NXY85_RS07425 comGE 1494550..1494897 (-) 348 WP_258729499.1 competence type IV pilus minor pilin ComGE Machinery gene

Sequence

Protein


Download         Length: 57 a.a.        Molecular weight: 6813.90 Da        Isoelectric Point: 10.0469

>NTDB_id=721654 NXY85_RS07380 WP_003325442.1 1490049..1490222(+) (sinI) [Bacillus atrophaeus strain NS2]
MKNAKKELLELDQEWVELMKRAREANINPEEIRKYLYLHKKSAHPVPATRSHTINPF

Nucleotide


Download         Length: 174 bp        

>NTDB_id=721654 NXY85_RS07380 WP_003325442.1 1490049..1490222(+) (sinI) [Bacillus atrophaeus strain NS2]
ATGAAAAATGCAAAAAAAGAGCTTTTAGAATTAGATCAAGAATGGGTTGAATTAATGAAAAGAGCCAGAGAAGCAAATAT
CAACCCGGAGGAGATACGCAAATATTTATATTTGCATAAAAAGTCTGCTCATCCTGTCCCAGCCACCAGAAGTCATACCA
TAAATCCTTTCTGA

Domains

Predicted by InterproScan.

Anti-repressor SinI (SinI)

(11-36)


Secondary structure

Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure

Source ID Structure

Transmembrane helices

Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.


Visualization of predicted probability:


Similar proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  sinI Bacillus subtilis subsp. subtilis str. 168

78.947

100

0.789