Detailed information    

insolico Bioinformatically predicted

Overview


Name   ssb   Type   Machinery gene
Locus tag   NV391_RS09220 Genome accession   NZ_CP103039
Coordinates   1799507..1800022 (-) Length   171 a.a.
NCBI ID   WP_420869526.1    Uniprot ID   -
Organism   Companilactobacillus crustorum strain X66     
Function   ssDNA binding (predicted from homology)   
DNA processing

Related MGE


Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.

Gene-MGE association summary

MGE type MGE coordinates Gene coordinates Relative position Distance (bp)
Prophage 1768405..1821187 1799507..1800022 within 0


Gene organization within MGE regions


Location: 1768405..1821187
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  NV391_RS08995 (NV391_09010) - 1768405..1768770 (+) 366 WP_274764744.1 winged helix-turn-helix transcriptional regulator -
  NV391_RS09000 (NV391_09015) - 1768753..1769085 (-) 333 WP_057867606.1 helix-turn-helix domain-containing protein -
  NV391_RS09005 (NV391_09020) - 1769552..1770421 (-) 870 WP_057867652.1 DegV family protein -
  NV391_RS09010 (NV391_09025) - 1771338..1772459 (-) 1122 WP_338078462.1 GH25 family lysozyme -
  NV391_RS09015 (NV391_09030) - 1772456..1772746 (-) 291 WP_274764745.1 holin -
  NV391_RS09020 (NV391_09035) - 1772733..1773059 (-) 327 WP_274764746.1 hypothetical protein -
  NV391_RS09025 (NV391_09040) - 1773052..1773438 (-) 387 WP_274764747.1 hypothetical protein -
  NV391_RS09030 (NV391_09045) - 1773475..1773606 (-) 132 WP_274764748.1 XkdX family protein -
  NV391_RS09035 (NV391_09050) - 1773620..1774039 (-) 420 WP_274764749.1 hypothetical protein -
  NV391_RS09040 (NV391_09055) - 1774050..1775321 (-) 1272 WP_274764750.1 hypothetical protein -
  NV391_RS09045 (NV391_09060) - 1775332..1775613 (-) 282 WP_274764751.1 hypothetical protein -
  NV391_RS09050 (NV391_09065) - 1775613..1776200 (-) 588 WP_274764752.1 phage tail protein -
  NV391_RS09055 (NV391_09070) - 1776201..1776995 (-) 795 WP_274764753.1 putative phage tail protein -
  NV391_RS09060 (NV391_09075) - 1776988..1778136 (-) 1149 WP_274764754.1 baseplate J/gp47 family protein -
  NV391_RS09065 (NV391_09080) - 1778126..1778488 (-) 363 WP_338078463.1 DUF2634 domain-containing protein -
  NV391_RS09070 (NV391_09085) - 1778490..1778834 (-) 345 WP_274764756.1 DUF2577 domain-containing protein -
  NV391_RS09075 (NV391_09090) - 1778831..1779886 (-) 1056 WP_274764758.1 XkdQ/YqbQ family protein -
  NV391_RS09080 (NV391_09095) - 1779883..1780572 (-) 690 WP_274764760.1 hypothetical protein -
  NV391_RS09085 (NV391_09100) - 1780585..1783659 (-) 3075 WP_274764762.1 tape measure protein -
  NV391_RS09090 (NV391_09105) - 1783891..1784304 (-) 414 WP_274764764.1 phage tail assembly chaperone -
  NV391_RS09095 (NV391_09110) - 1784319..1784804 (-) 486 WP_274764765.1 phage tail tube protein -
  NV391_RS09100 (NV391_09115) - 1784820..1786202 (-) 1383 WP_274764766.1 phage tail sheath family protein -
  NV391_RS09105 (NV391_09120) - 1786205..1786363 (-) 159 WP_274764767.1 hypothetical protein -
  NV391_RS09110 (NV391_09125) - 1786353..1786772 (-) 420 WP_274764768.1 phage tail terminator family protein -
  NV391_RS09115 (NV391_09130) - 1786769..1787203 (-) 435 WP_274764769.1 HK97 gp10 family phage protein -
  NV391_RS09120 (NV391_09135) - 1787184..1787582 (-) 399 WP_274764771.1 hypothetical protein -
  NV391_RS09125 (NV391_09140) - 1787579..1787965 (-) 387 WP_274764772.1 hypothetical protein -
  NV391_RS09130 (NV391_09145) - 1787976..1788098 (-) 123 WP_274764773.1 hypothetical protein -
  NV391_RS09135 (NV391_09150) - 1788107..1789027 (-) 921 WP_274764774.1 capsid protein -
  NV391_RS09140 (NV391_09155) - 1789034..1789588 (-) 555 WP_274764775.1 phage scaffolding protein -
  NV391_RS09145 (NV391_09160) - 1789696..1790721 (-) 1026 WP_274764776.1 minor capsid protein -
  NV391_RS09150 (NV391_09165) - 1790708..1792120 (-) 1413 WP_274764777.1 phage portal protein -
  NV391_RS09155 (NV391_09170) - 1792102..1793367 (-) 1266 WP_274764778.1 PBSX family phage terminase large subunit -
  NV391_RS09160 (NV391_09175) - 1793339..1794169 (-) 831 WP_274764779.1 terminase small subunit -
  NV391_RS09165 (NV391_09180) - 1794204..1794332 (-) 129 WP_274764780.1 hypothetical protein -
  NV391_RS09170 (NV391_09185) - 1794451..1795623 (-) 1173 WP_274764781.1 XRE family transcriptional regulator -
  NV391_RS09175 (NV391_09190) - 1795644..1796378 (-) 735 WP_274764782.1 hypothetical protein -
  NV391_RS09180 (NV391_09195) - 1796934..1797386 (-) 453 WP_274764783.1 ArpU family phage packaging/lysis transcriptional regulator -
  NV391_RS09185 (NV391_09200) - 1797540..1797776 (-) 237 WP_274764784.1 hypothetical protein -
  NV391_RS09190 (NV391_09205) - 1797754..1797972 (-) 219 WP_274764785.1 hypothetical protein -
  NV391_RS09195 (NV391_09210) - 1797976..1798191 (-) 216 WP_274764786.1 hypothetical protein -
  NV391_RS09200 (NV391_09215) - 1798188..1798538 (-) 351 WP_274764787.1 YopX family protein -
  NV391_RS09205 (NV391_09220) - 1798535..1798891 (-) 357 WP_274764788.1 DUF1828 domain-containing protein -
  NV391_RS09210 (NV391_09225) - 1798964..1799185 (-) 222 WP_274764789.1 hypothetical protein -
  NV391_RS09215 (NV391_09230) - 1799198..1799398 (-) 201 WP_274764790.1 hypothetical protein -
  NV391_RS09220 (NV391_09235) ssb 1799507..1800022 (-) 516 WP_420869526.1 single-stranded DNA-binding protein Machinery gene
  NV391_RS09225 (NV391_09240) - 1799988..1800197 (-) 210 WP_025025280.1 helix-turn-helix transcriptional regulator -
  NV391_RS09230 (NV391_09245) - 1800360..1800566 (+) 207 WP_274764792.1 hypothetical protein -
  NV391_RS09235 (NV391_09250) - 1800563..1800721 (-) 159 WP_155832140.1 hypothetical protein -
  NV391_RS09240 (NV391_09255) - 1800718..1801455 (-) 738 WP_274764793.1 Rha family transcriptional regulator -
  NV391_RS09245 (NV391_09260) - 1801452..1801883 (-) 432 WP_274764795.1 RusA family crossover junction endodeoxyribonuclease -
  NV391_RS09250 (NV391_09265) - 1801876..1802154 (-) 279 WP_274764796.1 helix-turn-helix domain-containing protein -
  NV391_RS09255 (NV391_09270) - 1802346..1803242 (-) 897 WP_274764797.1 DnaD domain protein -
  NV391_RS09260 (NV391_09275) - 1803256..1804059 (-) 804 WP_274764799.1 PD-(D/E)XK nuclease-like domain-containing protein -
  NV391_RS09265 (NV391_09280) - 1804040..1804930 (-) 891 WP_274764800.1 recombinase RecT -
  NV391_RS09270 (NV391_09285) - 1805111..1805362 (-) 252 WP_274764801.1 hypothetical protein -
  NV391_RS09275 (NV391_09290) - 1805375..1805608 (-) 234 WP_274764802.1 hypothetical protein -
  NV391_RS09280 (NV391_09295) - 1805611..1805943 (-) 333 WP_274764803.1 DUF771 domain-containing protein -
  NV391_RS09285 (NV391_09300) - 1805930..1806433 (-) 504 WP_274764804.1 hypothetical protein -
  NV391_RS09290 (NV391_09305) - 1806493..1806654 (+) 162 WP_274764806.1 hypothetical protein -
  NV391_RS09295 (NV391_09310) - 1806898..1807116 (-) 219 WP_153521777.1 helix-turn-helix transcriptional regulator -
  NV391_RS09300 (NV391_09315) - 1807256..1807618 (+) 363 WP_153521779.1 helix-turn-helix domain-containing protein -
  NV391_RS09305 (NV391_09320) - 1807608..1808018 (+) 411 WP_274764808.1 ImmA/IrrE family metallo-endopeptidase -
  NV391_RS09310 (NV391_09325) - 1808102..1808692 (+) 591 WP_274764809.1 DUF3862 domain-containing protein -
  NV391_RS09315 (NV391_09330) - 1808822..1809940 (+) 1119 WP_274764811.1 tyrosine-type recombinase/integrase -
  NV391_RS09325 (NV391_09340) - 1810315..1810836 (-) 522 WP_274764813.1 HdeD family acid-resistance protein -
  NV391_RS09330 (NV391_09345) - 1810960..1811610 (+) 651 WP_057867654.1 metal-dependent transcriptional regulator -
  NV391_RS09335 (NV391_09350) - 1811918..1812706 (-) 789 WP_057867655.1 DUF975 family protein -
  NV391_RS09340 (NV391_09355) - 1812764..1813696 (-) 933 WP_057867656.1 DUF4097 family beta strand repeat-containing protein -
  NV391_RS09345 (NV391_09360) - 1813689..1814351 (-) 663 WP_057867657.1 DUF1700 domain-containing protein -
  NV391_RS09350 (NV391_09365) - 1814341..1814658 (-) 318 WP_057867658.1 PadR family transcriptional regulator -
  NV391_RS09355 (NV391_09370) - 1815198..1815851 (+) 654 WP_274764814.1 amino acid ABC transporter permease -
  NV391_RS09360 (NV391_09375) - 1815864..1816502 (+) 639 WP_075887344.1 amino acid ABC transporter ATP-binding protein -
  NV391_RS09365 (NV391_09380) - 1816522..1817376 (+) 855 WP_274764815.1 amino acid ABC transporter substrate-binding protein -
  NV391_RS09370 (NV391_09385) - 1817475..1818452 (-) 978 WP_274764817.1 ADP-ribosylglycohydrolase family protein -
  NV391_RS09375 (NV391_09390) - 1818883..1819356 (+) 474 WP_057867664.1 nucleoside 2-deoxyribosyltransferase -
  NV391_RS09380 (NV391_09395) - 1819367..1819918 (+) 552 WP_075887341.1 TetR/AcrR family transcriptional regulator -
  NV391_RS09385 (NV391_09400) - 1820009..1821187 (+) 1179 WP_075887340.1 CynX/NimT family MFS transporter -

Sequence


Protein


Download         Length: 171 a.a.        Molecular weight: 19038.82 Da        Isoelectric Point: 4.9675

>NTDB_id=721142 NV391_RS09220 WP_420869526.1 1799507..1800022(-) (ssb) [Companilactobacillus crustorum strain X66]
MNLEVIIQMINRAILVGRLTRDPELRYTANGAAVASFTVAVNRTFTNSQGEREADFINCTIWRKAAENFANLVHKGSLVG
IDGRIQTSSYDNQQGQRVYRTDVIVENFSKLEWDNDSNGQSNGHADNQASKSSSTSSYSNQRADNMQKNNNTDPFADKGK
PIDISDDDLPF

Nucleotide


Download         Length: 516 bp        

>NTDB_id=721142 NV391_RS09220 WP_420869526.1 1799507..1800022(-) (ssb) [Companilactobacillus crustorum strain X66]
ATGAATTTAGAGGTGATAATACAAATGATAAATAGAGCAATCCTAGTAGGTCGCCTGACACGTGATCCGGAGCTTCGATA
TACAGCTAATGGTGCAGCAGTTGCTAGTTTTACAGTTGCTGTTAATCGTACATTTACTAACTCACAAGGCGAACGTGAAG
CCGACTTTATCAATTGTACTATTTGGCGAAAAGCTGCTGAGAACTTTGCTAATTTAGTTCATAAAGGTTCACTCGTTGGC
ATTGATGGACGTATTCAAACAAGTTCATATGACAATCAGCAAGGACAACGAGTTTACAGAACAGATGTCATTGTAGAAAA
CTTCTCAAAGCTTGAATGGGATAACGATTCAAATGGTCAATCTAATGGGCATGCAGATAATCAAGCAAGTAAATCCAGTA
GTACCAGTAGCTACAGCAATCAACGTGCAGATAATATGCAGAAAAACAATAATACCGATCCATTCGCTGACAAAGGAAAA
CCTATTGATATTAGTGACGATGACCTTCCATTCTAA


Secondary structure


Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure


Source ID Structure

Transmembrane helices


Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.



Visualization of predicted probability:


Similar proteins


Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  ssb Latilactobacillus sakei subsp. sakei 23K

59.412

99.415

0.591

  ssbA Bacillus subtilis subsp. subtilis str. 168

55.814

100

0.561